JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB307786

Recombinant Human MICA Protein (His-tag) (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MICA Protein (His-tag) (Active) is a Human Fragment protein, in the 24 to 308 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for HPLC, SDS-PAGE, Mass Spec, FuncS.

View Alternative Names

PERB11.1, MICA, MHC class I polypeptide-related sequence A, MIC-A

4 Images
Biological Activity - Recombinant Human MICA Protein (His-tag) (Active) (AB307786)
  • Biological Activity

Lab

Biological Activity - Recombinant Human MICA Protein (His-tag) (Active) (AB307786)

Loaded Human NKG2D, Fc Tag on Protein A Biosensor can bind Human MICA, His Tag with an affinity constant of 141 nM as determined in BLI assay (GatorBio Prime).

Mass Spectrometry - Recombinant Human MICA Protein (His-tag) (Active) (AB307786)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human MICA Protein (His-tag) (Active) (AB307786)

Mass determination by ESI-TOF. Predicted MW is 34341.59 Da (+/-10 Da by ESI-TOF). Observed MW is 34348.97 Da.

SDS-PAGE - Recombinant Human MICA Protein (His-tag) (Active) (AB307786)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human MICA Protein (His-tag) (Active) (AB307786)

SDS-PAGE analysis of ab307786

HPLC - Recombinant Human MICA Protein (His-tag) (Active) (AB307786)
  • HPLC

Supplier Data

HPLC - Recombinant Human MICA Protein (His-tag) (Active) (AB307786)

HPLC analysis of ab307786

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

Mass Spec, SDS-PAGE, FuncS, HPLC

applications

Biologically active

Yes

Biological activity

Loaded Human NKG2D, Fc Tag on Protein A Biosensor can bind Human MICA, His Tag with an affinity constant of 141 nM as determined in BLI assay (GatorBio Prime).

Accession

Q29983

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ","proteinLength":"Fragment","predictedMolecularWeight":"34.34 kDa","actualMolecularWeight":"34.35 kDa","aminoAcidEnd":308,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q29983","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MICA also known as MHC class I polypeptide-related sequence A is a protein encoded by the MICA gene. It has a molecular weight of approximately 62 kDa. MICA is a stress-induced ligand expressed on the surface of various cell types including epithelial cells fibroblasts and some tumor cells. This protein is part of the MHC class I chain-related (MIC) family which plays an important role in the immune system by interacting with natural killer (NK) cells and certain T cells.
Biological function summary

The MICA protein acts as a ligand for the NKG2D receptor an activating receptor found on NK cells and some T-cell subsets. MICA does not require expression as part of a complex with β2-microglobulin for function. When cells express MICA they signal distress allowing immune cells to target and destroy potentially harmful cells such as those infected with viruses or transformed into cancer cells. This interaction is an important component of the immune surveillance system.

Pathways

MICA functions within the natural cytotoxicity effector pathway heavily involved in immune responses. It is also relevant in the DNA damage response pathways. Within these pathways MICA interacts with proteins like NKG2D and plays a part in mediating cellular responses to stress and damage. These interactions enhance the capacity of immune cells to recognize and eliminate abnormal cells.

MICA is associated with conditions such as psoriasis and certain types of cancer. Studies have shown increased levels of soluble MICA in the sera of patients with psoriasis indicating a role in inflammation. Additionally in cancer MICA expression affects tumor immunity connecting to the NKG2D receptor to influence immune cell targeting and destruction of tumor cells. Researchers use tools such as MICA ELISA kits and imaging techniques to study its role in these diseases.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE >= 95%

General info

Function

Widely expressed membrane-bound protein which acts as a ligand to stimulate an activating receptor KLRK1/NKG2D, expressed on the surface of essentially all human natural killer (NK), gammadelta T and CD8 alphabeta T-cells (PubMed : 11491531, PubMed : 11777960). Up-regulated in stressed conditions, such as viral and bacterial infections or DNA damage response, serves as signal of cellular stress, and engagement of KLRK1/NKG2D by MICA triggers NK-cells resulting in a range of immune effector functions, such as cytotoxicity and cytokine production (PubMed : 10426993).

Sequence similarities

Belongs to the MHC class I family. MIC subfamily.

Post-translational modifications

N-glycosylated. Glycosylation is not essential for interaction with KLRK1/NKG2D but enhances complex formation.. Proteolytically cleaved and released from the cell surface of tumor cells which impairs KLRK1/NKG2D expression and T-cell activation.. Palmitoylated on cysteine residues in the cytoplasmic tail leading to its association with membrane microdomains enriched in cholesterol.. N-glycosylation is necessary for cell surface expression.. (Microbial infection) Ubiquitinated by human herpesvirus 8 protein K5, leading to degradation.

Product protocols

Target data

Widely expressed membrane-bound protein which acts as a ligand to stimulate an activating receptor KLRK1/NKG2D, expressed on the surface of essentially all human natural killer (NK), gammadelta T and CD8 alphabeta T-cells (PubMed : 11491531, PubMed : 11777960). Up-regulated in stressed conditions, such as viral and bacterial infections or DNA damage response, serves as signal of cellular stress, and engagement of KLRK1/NKG2D by MICA triggers NK-cells resulting in a range of immune effector functions, such as cytotoxicity and cytokine production (PubMed : 10426993).
See full target information MICA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com