JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB202240

Recombinant Human MKK6 protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MKK6 protein (denatured) (His tag N-Terminus) is a Human Fragment protein, in the 53 to 314 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

MEK6, MKK6, PRKMK6, SKK3, MAP2K6, Dual specificity mitogen-activated protein kinase kinase 6, MAP kinase kinase 6, MAPKK 6, MAPK/ERK kinase 6, Stress-activated protein kinase kinase 3, MEK 6, SAPK kinase 3, SAPKK-3, SAPKK3

1 Images
SDS-PAGE - Recombinant Human MKK6 protein (denatured) (His tag N-Terminus) (AB202240)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human MKK6 protein (denatured) (His tag N-Terminus) (AB202240)

15% SDS-PAGE analysis of ab202240 (3μg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P52564

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as MEK6

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDEVAKEIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFF","proteinLength":"Fragment","predictedMolecularWeight":"32 kDa","actualMolecularWeight":null,"aminoAcidEnd":314,"aminoAcidStart":53,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P52564","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MKK6 also known as MAP2K6 functions as a dual-specificity kinase within cellular signaling processes. It belongs to the MAP kinase kinase (MAP2K) family and specifically activates p38 MAP kinase by phosphorylation. This protein weighs approximately 38 kDa and is expressed in various tissues with higher levels often found in the brain heart and skeletal muscle. MKK6 plays a significant role in transmitting signals that regulate cellular responses to stress and inflammation.
Biological function summary

This protein modulates important cellular mechanisms by acting as an important component of the p38 MAPK signaling cascade. It interacts with other kinases to form signaling complexes that mediate responses like cell growth division and apoptosis. MKK6 becomes activated in response to environmental stressors and cytokines triggering a phosphorylation cascade that concludes with the activation of p38 MAPK which then enters the nucleus to influence gene expression.

Pathways

MKK6 integrates into the MAPK signaling pathway particularly in stress response and inflammatory signaling pathways. The protein activates p38 MAPK an important player in these pathways and associates with other proteins such as MKK3 and MKK4 to regulate diverse cellular activities. This activation is a part of well-established pathways like cytokine production and response to DNA damage offering comprehensive regulation of cellular homeostasis.

MKK6 involvement links to inflammatory conditions and stress-related pathologies. It has been implicated in diseases like rheumatoid arthritis where its activity relates to increased inflammatory responses and also in cancer contributing to tumor growth and survival via p38 MAPK activation. Through these conditions MKK6 connects closely with other proteins within the MAPK pathway including p38 MAPK which plays a role in the alteration of cellular proliferation and apoptosis often observed in pathological states.

Specifications

Form

Liquid

Additional notes

Purified using conventional chromatography techniques.

General info

Function

Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases.

Sequence similarities

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.

Post-translational modifications

Weakly autophosphorylated. Phosphorylated at Ser-207 and Thr-211 by the majority of M3Ks, such as MAP3K5/ASK1, MAP3K1/MEKK1, MAP3K2/MEKK2, MAP3K3/MEKK3, MAP3K4/MEKK4, MAP3K7/TAK1, MAP3K11/MLK3 and MAP3K17/TAOK2.. (Microbial infection) Acetylation of Ser-207 and Thr-211 by Yersinia YopJ prevents phosphorylation and activation, thus blocking the MAPK signaling pathway.

Subcellular localisation

Nucleus

Product protocols

Target data

Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases.
See full target information MAP2K6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com