JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276608

Recombinant Human MMGT1 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MMGT1 protein (His tag) is a Human Fragment protein, in the 66 to 131 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

EMC5, TMEM32, MMGT1, ER membrane protein complex subunit 5, Membrane magnesium transporter 1, Transmembrane protein 32

1 Images
SDS-PAGE - Recombinant Human MMGT1 protein (His tag) (AB276608)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human MMGT1 protein (His tag) (AB276608)

SDS-PAGE analysis of ab276608

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q8N4V1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR","proteinLength":"Fragment","predictedMolecularWeight":"10.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":131,"aminoAcidStart":66,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q8N4V1","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MMGT1 also known by its alternate names Magnesium Transporter 1 and Solute Carrier Family 41 Member 1 plays an important role in magnesium homeostasis. It encodes a protein with an approximate mass of 45 kDa. This protein localizes primarily in the cell membrane facilitating the transport of magnesium ions across the membrane. MMGT1 is expressed in a wide range of tissues including the heart skeletal muscle and kidneys reflecting its importance in various physiological processes.
Biological function summary

MMGT1 ensures magnesium ion balance within cells acting as an essential transporter. It may form a part of larger protein complexes allowing for precise regulation and distribution of magnesium ions in response to cellular needs. Magnesium serves as a cofactor for many enzymes playing a part in processes such as protein synthesis and energy production highlighting the significance of MMGT1 in cellular activities. By controlling magnesium transport MMGT1 contributes to maintaining cellular stability and optimal function.

Pathways

MMGT1 has connections to key biological pathways related to magnesium metabolism and cellular ion regulation. It interacts with other proteins such as members of the TRPM family which are also involved in mediating magnesium transport and signal transduction. Magnesium plays a critical role in signal transduction pathways and helps regulate kinase activities further linking MMGT1 to important cellular signaling dynamics.

MMGT1 has a potential link to conditions such as hypomagnesemia and metabolic syndrome. Deficient magnesium transport due to MMGT1 malfunction can lead to low serum magnesium levels disrupting metabolic processes and potentially leading to these disorders. Through these disease pathways MMGT1 interacts with other proteins including parathyroid hormone which is important for calcium and magnesium homeostasis. Understanding the role of MMGT1 in these conditions could offer insights into therapeutic targets for managing magnesium-related diseases.

Specifications

Form

Lyophilized

General info

Function

Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins (PubMed : 29242231, PubMed : 29809151, PubMed : 30415835, PubMed : 32439656, PubMed : 32459176). Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues (PubMed : 29242231, PubMed : 29809151, PubMed : 30415835). Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices (PubMed : 29809151, PubMed : 30415835). It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes (PubMed : 29242231, PubMed : 29809151). By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors (PubMed : 30415835). By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (By similarity). May be involved in Mg(2+) transport (By similarity).

Sequence similarities

Belongs to the membrane magnesium transporter (TC 1.A.67) family.

Subcellular localisation

Early endosome membrane

Product protocols

Target data

Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins (PubMed : 29242231, PubMed : 29809151, PubMed : 30415835, PubMed : 32439656, PubMed : 32459176). Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues (PubMed : 29242231, PubMed : 29809151, PubMed : 30415835). Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices (PubMed : 29809151, PubMed : 30415835). It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes (PubMed : 29242231, PubMed : 29809151). By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors (PubMed : 30415835). By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (By similarity). May be involved in Mg(2+) transport (By similarity).
See full target information MMGT1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com