JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177626

Recombinant Human MMP13 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MMP13 protein (His tag N-Terminus) is a Human Fragment protein, in the 104 to 471 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Collagenase 3, Matrix metalloproteinase-13, MMP-13, MMP13

1 Images
SDS-PAGE - Recombinant Human MMP13 protein (His tag N-Terminus) (AB177626)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human MMP13 protein (His tag N-Terminus) (AB177626)

15% SDS-PAGE analysis of ab177626 (3 μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P45452

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris-HCl buffer, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC","proteinLength":"Fragment","predictedMolecularWeight":"44.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":471,"aminoAcidStart":104,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P45452","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Matrix metallopeptidase 13 (MMP-13) also called collagenase 3 is an enzyme with an approximate molecular mass of 54 kDa. It plays a significant role in the breakdown of extracellular matrix components particularly collagen. MMP-13 is expressed in several tissues including cartilage skin and bone. Its expression sees an increase during tissue remodeling and in pathological conditions. MMP-13 also participates in processes like wound healing and embryonic development making it a focal point for understanding tissue dynamics.
Biological function summary

Matrix metallopeptidase 13 contributes extensively to the degradation of collagen type II a major component of cartilage. As a zinc-dependent endopeptidase MMP-13 is part of the MMP family which facilitates the remodeling of the extracellular matrix. MMP-13 is involved in the proteolytic cascade working in conjunction with other MMPs and elastase to mediate tissue repair and turnover. It does not form complexes but acts in concert with other enzymes to execute its physiological functions effectively.

Pathways

Matrix metallopeptidase 13 significance is most noted in the cartilage degradation pathway. It interacts with other MMPs such as MMP-1 and MMP-9 to efficiently break down extracellular matrix components. These interactions highlight its role in the regulation of matrix metalloproteinase activity within the connective tissue degradation pathway. These pathways are key during normal connective tissue remodeling and in pathological processes illustrating the essential roles of MMPs in maintaining tissue homeostasis.

Matrix metallopeptidase 13 has strong associations with osteoarthritis and rheumatoid arthritis. It contributes to cartilage destruction intensifying the progression of these disorders due to its potent collagenolytic activity. Other proteins like MMP-9 and MMP-14 are also involved in these processes potentially amplifying tissue damage in affected joints. Understanding how MMP-13 and related proteins drive these diseases offers potential therapeutic targets for slowing disease progression and enhancing joint health.

Specifications

Form

Liquid

Additional notes

ab177626 was purified by using conventional chromatography techniques.

General info

Function

Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CCN2. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CCN2. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion.

Sequence similarities

Belongs to the peptidase M10A family.

Post-translational modifications

The proenzyme is activated by removal of the propeptide; this cleavage can be effected by other matrix metalloproteinases, such as MMP2, MMP3 and MMP14 and may involve several cleavage steps. Cleavage can also be autocatalytic, after partial maturation by another protease or after treatment with 4-aminophenylmercuric acetate (APMA) (in vitro).. N-glycosylated.. Tyrosine phosphorylated by PKDCC/VLK.

Product protocols

Target data

Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CCN2. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CCN2. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion.
See full target information MMP13

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com