JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB102026

Recombinant Human Mob1A protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Mob1A protein is a Human Full Length protein, in the 1 to 216 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

C2orf6, MOB4B, MOBK1B, MOBKL1B, MOB1A, MOB kinase activator 1A, Mob1 alpha, Mob1 homolog 1B, Mps one binder kinase activator-like 1B, Mob1A

1 Images
SDS-PAGE - Recombinant Human Mob1A protein (AB102026)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Mob1A protein (AB102026)

15% SDS-PAGE analysis of ab102026 (3μg)

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9H8S9

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as MOBK1B

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR","proteinLength":"Full Length","predictedMolecularWeight":"27.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":216,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9H8S9","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Mob1A also known as Mps One Binder kinase activator-like 1A is a protein involved in cell signaling pathways. It has a molecular mass of approximately 25 kDa. Mob1A is found in various tissues but it shows elevated expression levels in the liver kidney and lung. Its structural attributes contribute to interacting with other cellular proteins assisting in regulation of cell cycle progression.
Biological function summary

Mob1A acts as a core component of the Hippo signaling pathway playing an important role in cell proliferation and apoptosis regulation. It forms a complex with large tumor suppressor kinase 1 (LATS1) and facilitates interaction with other pathway components. The interaction with LATS1 enhances the phosphorylation activity which then has further consequences for cellular processes. This function is critical for preventing uncontrolled cell growth and ensuring proper organ size is maintained.

Pathways

Mob1A participates in the Hippo and Wnt signaling pathways. Within the Hippo pathway Mob1A works closely with proteins such as YAP/TAZ which are regulatory proteins important for gene expression control. In the Wnt pathway Mob1A contributes indirectly to cell fate determination. These connections highlight its importance in managing cellular growth and differentiation requiring careful orchestration of its interactions.

Mob1A shows significant involvement in cancer and liver diseases. Dysregulation within the Hippo pathway where Mob1A plays an important role often leads to tumorigenesis due to increased cellular proliferation. Research shows correlations between altered Mob1A function and hepatocellular carcinoma where Mob1A interacts with other proteins like MST1/2 to influence disease progression. Understanding these interactions may offer therapeutic insights for managing such conditions.

Specifications

Form

Liquid

Additional notes

ab102026 was purified using conventional chromatography techniques.

General info

Function

Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L. Acts cooperatively with STK3/MST2 to activate STK38.

Sequence similarities

Belongs to the MOB1/phocein family.

Post-translational modifications

Phosphorylated by STK3/MST2 and STK4/MST1 and this phosphorylation enhances its binding to LATS1.

Product protocols

Target data

Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L. Acts cooperatively with STK3/MST2 to activate STK38.
See full target information MOB1A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com