JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB225648

Recombinant Human MORC3 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MORC3 protein (Tagged) is a Human Fragment protein, in the 1 to 290 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

KIAA0136, NXP2, ZCWCC3, MORC3, MORC family CW-type zinc finger protein 3, Nuclear matrix protein 2, Zinc finger CW-type coiled-coil domain protein 3

1 Images
SDS-PAGE - Recombinant Human MORC3 protein (Tagged) (AB225648)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human MORC3 protein (Tagged) (AB225648)

Discontinuous SDS-PAGE (Tris-Glycine gel) (reduced) with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

6x His tag N-Terminus SUMO tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q14149

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY","proteinLength":"Fragment","predictedMolecularWeight":"48.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":290,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q14149","tags":[{"tag":"6x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"}]}]

Properties and storage information

Form
Liquid
Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MORC3 also known as Microrchidia CW-type zinc finger protein 3 is a nuclear protein with a molecular weight of approximately 100 kDa. It functions as part of chromatin remodeling processes and is found within the nucleus of cells. MORC3 exhibits a high level of expression in testes and other tissues supporting its role in transcription regulation and nuclear body formation. It also contains several domains such as ATPase zinc finger and a nuclear localization signal which are critical for its mechanical action within the cell.
Biological function summary

MORC3 influences nuclear dynamics and chromatin organization. It plays a central role in the formation of promyelocytic leukemia nuclear bodies (PML-NBs) which are involved in gene regulation DNA repair and apoptosis. MORC3 can interact with proteins within PML-NBs indicating it’s part of a protein complex that maintains genomic stability. This organizational role supports various cellular processes by regulating gene expression patterns in response to stress and damage.

Pathways

MORC3 integrates into different signaling pathways including DNA damage response and gene repression-specific pathways. It participates in the p53 signaling pathway where its interaction with proteins like p300 influences transcriptional activation of p53 target genes. Moreover MORC3's involvement in these pathways highlights processes such as cell cycle regulation apoptosis and maintenance of genomic integrity under stress conditions.

MORC3 has been associated with autoimmune conditions and cancer. Variants or dysregulation in MORC3 expression can relate to systemic lupus erythematosus where it impacts immune responses through proteins like TRIM21 known for its role in autoimmunity. Additionally changes in MORC3 expression levels have correlations with certain cancer types where aberrant nuclear body formation affects cell proliferation and survival mechanisms.

General info

Function

Nuclear matrix protein which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism and plays a role in innate immunity by restricting different viruses through modulation of the IFN response (PubMed : 27440897, PubMed : 34759314). Mechanistically, possesses a primary antiviral function through a MORC3-regulated element that activates IFNB1, and this function is guarded by a secondary IFN-repressing function (PubMed : 34759314). Sumoylated MORC3-NBs associates with PML-NBs and recruits TP53 and SP100, thus regulating TP53 activity (PubMed : 17332504, PubMed : 20501696). Binds RNA in vitro (PubMed : 11927593). Histone methylation reader which binds to non-methylated (H3K4me0), monomethylated (H3K4me1), dimethylated (H3K4me2) and trimethylated (H3K4me3) 'Lys-4' on histone H3 (PubMed : 26933034). The order of binding preference is H3K4me3 > H3K4me2 > H3K4me1 > H3K4me0 (PubMed : 26933034).. (Microbial infection) May be required for influenza A transcription during viral infection (PubMed : 26202233).

Post-translational modifications

Sumoylation is involved in interaction with PML and localization to PML nuclear bodies.

Subcellular localisation

Nucleus

Product protocols

Target data

Nuclear matrix protein which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism and plays a role in innate immunity by restricting different viruses through modulation of the IFN response (PubMed : 27440897, PubMed : 34759314). Mechanistically, possesses a primary antiviral function through a MORC3-regulated element that activates IFNB1, and this function is guarded by a secondary IFN-repressing function (PubMed : 34759314). Sumoylated MORC3-NBs associates with PML-NBs and recruits TP53 and SP100, thus regulating TP53 activity (PubMed : 17332504, PubMed : 20501696). Binds RNA in vitro (PubMed : 11927593). Histone methylation reader which binds to non-methylated (H3K4me0), monomethylated (H3K4me1), dimethylated (H3K4me2) and trimethylated (H3K4me3) 'Lys-4' on histone H3 (PubMed : 26933034). The order of binding preference is H3K4me3 > H3K4me2 > H3K4me1 > H3K4me0 (PubMed : 26933034).. (Microbial infection) May be required for influenza A transcription during viral infection (PubMed : 26202233).
See full target information MORC3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com