JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB105615

Recombinant Human MRGX protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MRGX protein is a Human Full Length protein, in the 1 to 288 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

KIAA0026, MRGX, MORF4L2, Mortality factor 4-like protein 2, MORF-related gene X protein, Protein MSL3-2, Transcription factor-like protein MRGX

1 Images
SDS-PAGE - Recombinant Human MRGX protein (AB105615)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human MRGX protein (AB105615)

3 ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q15014

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL","proteinLength":"Full Length","predictedMolecularWeight":"34.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":288,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q15014","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MRGX also known as Mas-related G protein-coupled receptor member X functions as a G protein-coupled receptor (GPCR) involved in sensing environmental stimuli and transducing signals inside cells. Researchers find this receptor in sensory neurons within the dorsal root ganglia and trigeminal ganglia. MRGX weighs approximately 37 kDa and plays a role in pain perception and modulation by interacting with various ligands. Understanding its mechanical function helps in exploring its wide applications in sensory biology.
Biological function summary

This receptor contributes to the modulation of nociceptive signals and influences pain sensation and response. MRGX does not form part of a complex; it functions independently to modulate pain pathways by interacting with peptides and other small molecules. It also regulates calcium ion concentrations within neurons which is essential for neurotransmission and signal propagation. The interaction of MRGX with these elements highlights its significant contribution to the sensory regulatory processes.

Pathways

Research associates MRGX with pain perception and sensory transmission pathways. It intersects with the neuropeptide signaling pathway influencing proteins such as substance P and calcitonin gene-related peptide (CGRP) both key players in pain signal pathways. MRGX modulates the activity of these signaling molecules affecting how the body interprets and reacts to painful stimuli. This receptor's involvement in these pathways demonstrates its impact on the physiological responses to pain.

MRGX is linked to conditions such as neuropathic pain and inflammatory pain. Alterations in MRGX function or expression can influence the severity of pain-related phenomena implicating it in these conditions. The association of MRGX with proteins like TRPV1 and Nav1.8 which are involved in pain pathways further solidifies its connection to these disorders. Understanding these interactions offers insights into potential therapeutic avenues for treating chronic pain syndromes.

Specifications

Form

Liquid

Additional notes

Purified using conventional chromatography.

General info

Function

Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also a component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones.

Subcellular localisation

Nucleus

Product protocols

Target data

Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also a component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones.
See full target information MORF4L2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com