JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB140733

Recombinant Human MRI protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MRI protein is a Human Full Length protein, in the 1 to 157 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

C7orf49, MRI, CYREN, Cell cycle regulator of non-homologous end joining, Cell cycle regulator of NHEJ, Modulator of retrovirus infection homolog

1 Images
SDS-PAGE - Recombinant Human MRI protein (AB140733)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human MRI protein (AB140733)

15% SDS-PAGE analysis of ab140733 (3μg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q9BWK5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMETLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS","proteinLength":"Full Length","predictedMolecularWeight":"19.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":157,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9BWK5","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Magnetic Resonance Imaging (MRI) is not a protein or biological target in the traditional sense but is a powerful imaging technique used in the life sciences. MRI functions mechanically by generating strong magnetic fields and radio waves to produce detailed images of organs and tissues. It does not express any mass because it is an instrument not a biomolecule. MRI is widely used across many fields and is essential in hospitals and research settings. Despite not being a protein MRI relies on the interaction with hydrogen protons particularly prevalent in water and fat to provide high-resolution images of soft tissues.
Biological function summary

MRI provides critical insights into the structure and function of the human body by visualizing soft tissues in great detail. This technology plays a powerful role in identifying the complex anatomy of tissues and organs giving it a significant presence in medical diagnostics. MRI can assess functional aspects of biological processes through techniques like functional MRI (fMRI) which measures brain activity by detecting changes in blood flow. Though MRI is not a biological molecule or part of any specific complex it contributes substantially to biological research by helping understand tissue composition and organ dysfunctions.

Pathways

MRI significantly impacts the study of biological processes and pathways by allowing detailed observation of real-time physiological processes. MRI is indispensable in evaluating the pathways related to neurological and cardiovascular systems. For example it aids in the visualization of neural connections and the assessment of blood vessels offering insights into the dynamic processes within these networks. Despite not being directly involved with molecular pathways MRI complements studies involving proteins such as those implicated in neural signaling or cardiac muscle contractions by enabling precise structural and functional assessments.

MRI offers invaluable aid in diagnosing and monitoring various conditions including brain disorders and cardiovascular diseases. MRI’s high-resolution imaging helps identify abnormalities like tumors lesions or ischemic areas with precision often involving proteins like amyloid beta in Alzheimer's disease or troponin in conditions related to the heart. By visualizing disease progression or treatment impact MRI supports the understanding and management of these disorders making it an important tool in clinical practice and research.

Specifications

Form

Liquid

Additional notes

ab140733 was purified using conventional chromatography techniques.

General info

Function

Cell-cycle-specific regulator of classical non-homologous end joining (NHEJ) of DNA double-strand break (DSB) repair, which can act both as an activator or inhibitor of NHEJ, depending on the cell cycle phase (PubMed : 24610814, PubMed : 28959974). Acts as a regulator of DNA repair pathway choice by specifically inhibiting classical NHEJ during the S and G2 phases, thereby promoting error-free repair by homologous recombination during cell cycle phases when sister chromatids are present (PubMed : 28959974). Preferentially protects single-stranded overhangs at break sites by inhibiting classical NHEJ, thereby creating a local environment that favors homologous recombination (PubMed : 28959974). Acts via interaction with XRCC5/Ku80 and XRCC6/Ku70 (PubMed : 28959974). In contrast, acts as an activator of NHEJ during G1 phase of the cell cycle : promotes classical NHEJ in G1 phase cells via multivalent interactions that increase the affinity of DNA damage response proteins for DSB-associated chromatin. Also involved in immunoglobulin V(D)J recombination (By similarity). May also act as an indirect regulator of proteasome (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

Cell-cycle-specific regulator of classical non-homologous end joining (NHEJ) of DNA double-strand break (DSB) repair, which can act both as an activator or inhibitor of NHEJ, depending on the cell cycle phase (PubMed : 24610814, PubMed : 28959974). Acts as a regulator of DNA repair pathway choice by specifically inhibiting classical NHEJ during the S and G2 phases, thereby promoting error-free repair by homologous recombination during cell cycle phases when sister chromatids are present (PubMed : 28959974). Preferentially protects single-stranded overhangs at break sites by inhibiting classical NHEJ, thereby creating a local environment that favors homologous recombination (PubMed : 28959974). Acts via interaction with XRCC5/Ku80 and XRCC6/Ku70 (PubMed : 28959974). In contrast, acts as an activator of NHEJ during G1 phase of the cell cycle : promotes classical NHEJ in G1 phase cells via multivalent interactions that increase the affinity of DNA damage response proteins for DSB-associated chromatin. Also involved in immunoglobulin V(D)J recombination (By similarity). May also act as an indirect regulator of proteasome (By similarity).
See full target information CYREN

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com