JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112272

Recombinant Human MRP2 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MRP2 protein (GST tag N-Terminus) is a Human protein, in the 214 to 313 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

CMOAT, CMOAT1, CMRP, MRP2, ABCC2, ATP-binding cassette sub-family C member 2, Canalicular multidrug resistance protein, Canalicular multispecific organic anion transporter 1, Multidrug resistance-associated protein 2

1 Images
SDS-PAGE - Recombinant Human MRP2 protein (GST tag N-Terminus) (AB112272)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human MRP2 protein (GST tag N-Terminus) (AB112272)

12.5% SDS-PAGE Stained with Coomassie Blue

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

Q92887

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein)</p>" } } }

Product details

This product is useful for Antibody Production and Protein Array.

Sequence info

[{"sequence":"LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA","proteinLength":null,"predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":313,"aminoAcidStart":214,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q92887","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MRP2 also known as ABCC2 or MRP-2 transporter is an ATP-binding cassette transporter. This protein with a molecular mass of about 190 kDa is widely expressed in tissues such as the liver kidney and intestine. MRP2 plays a role in drug and metabolite transport moving various organic anions across cellular membranes. It locates to the canalicular membrane of hepatocytes where it functions in secreting conjugated bilirubin and drugs into bile.
Biological function summary

MRP2 contributes to cellular detoxification processes. It does not form part of a larger protein complex but works as an independent entity. MRP2 protein actively transports conjugated substances out of cells protecting tissues from potential damage from toxins drugs and other organic anions. This transporter mediates the excretion of glucuronide sulfate and glutathione conjugates playing an important role in phase III of drug metabolism.

Pathways

MRP2 transporter is integral to xenobiotic metabolism. It interconnects with the conjugation pathways that prepare compounds for excretion. The pathway functions with cytochrome P450 enzymes and other related transport proteins like MDR1 facilitating the secretion of detoxified metabolites. MRP2 activity influences pharmacokinetics and pharmacodynamics by modulating drug disposition and excretion.

MRP2 is associated with Dubin-Johnson syndrome and cholestasis. Dubin-Johnson syndrome arises from mutations in the ABCC2 gene leading to defective bilirubin excretion and jaundice. Cholestasis involves impaired bile excretion where MRP2 and possibly related proteins like BSEP play roles in bile salt export. Understanding MRP2 functioning aids in assessing risk and treatment strategies for these conditions.

Specifications

Form

Liquid

General info

Function

ATP-dependent transporter of the ATP-binding cassette (ABC) family that binds and hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants and endogenous compound across cell membranes. Transports a wide variety of conjugated organic anions such as sulfate-, glucuronide- and glutathione (GSH)-conjugates of endo- and xenobiotics substrates (PubMed : 10220572, PubMed : 10421658, PubMed : 11500505, PubMed : 16332456). Mediates hepatobiliary excretion of mono- and bis-glucuronidated bilirubin molecules and therefore play an important role in bilirubin detoxification (PubMed : 10421658). Mediates also hepatobiliary excretion of others glucuronide conjugates such as 17beta-estradiol 17-glucosiduronic acid and leukotriene C4 (PubMed : 11500505). Transports sulfated bile salt such as taurolithocholate sulfate (PubMed : 16332456). Transports various anticancer drugs, such as anthracycline, vinca alkaloid and methotrexate and HIV-drugs such as protease inhibitors (PubMed : 10220572, PubMed : 11500505, PubMed : 12441801). Confers resistance to several anti-cancer drugs including cisplatin, doxorubicin, epirubicin, methotrexate, etoposide and vincristine (PubMed : 10220572, PubMed : 11500505).

Sequence similarities

Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.

Product protocols

Target data

ATP-dependent transporter of the ATP-binding cassette (ABC) family that binds and hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants and endogenous compound across cell membranes. Transports a wide variety of conjugated organic anions such as sulfate-, glucuronide- and glutathione (GSH)-conjugates of endo- and xenobiotics substrates (PubMed : 10220572, PubMed : 10421658, PubMed : 11500505, PubMed : 16332456). Mediates hepatobiliary excretion of mono- and bis-glucuronidated bilirubin molecules and therefore play an important role in bilirubin detoxification (PubMed : 10421658). Mediates also hepatobiliary excretion of others glucuronide conjugates such as 17beta-estradiol 17-glucosiduronic acid and leukotriene C4 (PubMed : 11500505). Transports sulfated bile salt such as taurolithocholate sulfate (PubMed : 16332456). Transports various anticancer drugs, such as anthracycline, vinca alkaloid and methotrexate and HIV-drugs such as protease inhibitors (PubMed : 10220572, PubMed : 11500505, PubMed : 12441801). Confers resistance to several anti-cancer drugs including cisplatin, doxorubicin, epirubicin, methotrexate, etoposide and vincristine (PubMed : 10220572, PubMed : 11500505).
See full target information ABCC2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com