JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB160907

Recombinant Human MRP4 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MRP4 protein is a Human Fragment protein, in the 1 to 110 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

MOATB, MRP4, ABCC4, ATP-binding cassette sub-family C member 4, MRP/cMOAT-related ABC transporter, Multi-specific organic anion transporter B, Multidrug resistance-associated protein 4, MOAT-B

1 Images
SDS-PAGE - Recombinant Human MRP4 protein (AB160907)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human MRP4 protein (AB160907)

ab160907 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

O15439

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQP","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":110,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O15439","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The MRP4 protein also known as Multidrug Resistance Protein 4 or ABCC4 is an ATP-binding cassette transporter with a mass of approximately 150 kDa. This protein is expressed in various tissues including the liver kidney and brain. It plays a mechanical role by transporting organic anions drugs and other xenobiotic compounds across cellular membranes. MRP4 is part of the wider ATP-binding cassette (ABC) transporter family which actively pumps substrates against concentration gradients using ATP hydrolysis.
Biological function summary

MRP4 impacts processes like pharmacokinetics and drug metabolism. The protein contributes to the efflux of endogenous substrates and medication from cells affecting their absorption and excretion. MRP4 also functions as part of a larger transporter complex working with other similar proteins to manage cellular detoxification systems. The MRP4 transporter maintains cellular homeostasis by removing harmful substances supporting cellular defense mechanisms against xenobiotic and endogenous compounds.

Pathways

MRP4 integrates into cellular processes such as prostaglandin and cyclic nucleotide signaling pathways. These pathways are important in regulating inflammatory responses and cardiovascular functions. MRP4 interacts with other proteins including MRP1 and MRP5 which facilitate the movement of similar substrates providing flexibility and redundancy within cellular transport systems. This involvement enables MRP4 to modulate biological effects via alteration in prostaglandin levels.

MRP4 connects to conditions such as cancer and viral infections. Elevated expression of MRP4 can lead to drug resistance in cancer therapy complicating treatment strategies. In viral infections MRP4 modulates the availability of nucleoside analogs used in antiviral therapies. The protein's role aligns with other transporters like P-glycoprotein showcasing its involvement in the multidrug resistance phenotype. Consequently understanding MRP4's function can aid in the development of new therapeutic approaches targeting these disorders.

Specifications

Form

Liquid

General info

Function

ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes physiological compounds and xenobiotics from cells. Transports a range of endogenous molecules that have a key role in cellular communication and signaling, including cyclic nucleotides such as cyclic AMP (cAMP) and cyclic GMP (cGMP), bile acids, steroid conjugates, urate, and prostaglandins (PubMed : 11856762, PubMed : 12523936, PubMed : 12835412, PubMed : 12883481, PubMed : 15364914, PubMed : 15454390, PubMed : 16282361, PubMed : 17959747, PubMed : 18300232, PubMed : 26721430). Mediates the ATP-dependent efflux of glutathione conjugates such as leukotriene C4 (LTC4) and leukotriene B4 (LTB4) too. The presence of GSH is necessary for the ATP-dependent transport of LTB4, whereas GSH is not required for the transport of LTC4 (PubMed : 17959747). Mediates the cotransport of bile acids with reduced glutathione (GSH) (PubMed : 12523936, PubMed : 12883481, PubMed : 16282361). Transports a wide range of drugs and their metabolites, including anticancer, antiviral and antibiotics molecules (PubMed : 11856762, PubMed : 12105214, PubMed : 15454390, PubMed : 17344354, PubMed : 18300232). Confers resistance to anticancer agents such as methotrexate (PubMed : 11106685).

Sequence similarities

Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.

Post-translational modifications

N-glycosylated; leading to substrate-selective effects on its transport activity.

Product protocols

Target data

ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes physiological compounds and xenobiotics from cells. Transports a range of endogenous molecules that have a key role in cellular communication and signaling, including cyclic nucleotides such as cyclic AMP (cAMP) and cyclic GMP (cGMP), bile acids, steroid conjugates, urate, and prostaglandins (PubMed : 11856762, PubMed : 12523936, PubMed : 12835412, PubMed : 12883481, PubMed : 15364914, PubMed : 15454390, PubMed : 16282361, PubMed : 17959747, PubMed : 18300232, PubMed : 26721430). Mediates the ATP-dependent efflux of glutathione conjugates such as leukotriene C4 (LTC4) and leukotriene B4 (LTB4) too. The presence of GSH is necessary for the ATP-dependent transport of LTB4, whereas GSH is not required for the transport of LTC4 (PubMed : 17959747). Mediates the cotransport of bile acids with reduced glutathione (GSH) (PubMed : 12523936, PubMed : 12883481, PubMed : 16282361). Transports a wide range of drugs and their metabolites, including anticancer, antiviral and antibiotics molecules (PubMed : 11856762, PubMed : 12105214, PubMed : 15454390, PubMed : 17344354, PubMed : 18300232). Confers resistance to anticancer agents such as methotrexate (PubMed : 11106685).
See full target information ABCC4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com