JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152443

Recombinant Human MSH6 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MSH6 protein is a Human Fragment protein, in the 931 to 1030 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

GTBP, MSH6, DNA mismatch repair protein Msh6, hMSH6, G/T mismatch-binding protein, MutS protein homolog 6, MutS-alpha 160 kDa subunit, GTMBP, p160

1 Images
SDS-PAGE - Recombinant Human MSH6 protein (AB152443)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human MSH6 protein (AB152443)

12.5% SDS-PAGE analysis of ab152443 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

P52701

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK","proteinLength":"Fragment","predictedMolecularWeight":"36.74 kDa","actualMolecularWeight":null,"aminoAcidEnd":1030,"aminoAcidStart":931,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P52701","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MSH6 also known as MutS Homolog 6 is a DNA repair protein that plays a role in the mismatch repair (MMR) system. It has a molecular mass of approximately 136 kDa. MSH6 forms a heterodimer with MSH2 called MutSα and this complex identifies base-pair mismatches and insertion-deletion loops during DNA replication. It is expressed in various tissues throughout the body and high levels are often found in proliferative tissues where active DNA replication occurs.
Biological function summary

MSH6 functions as part of the MMR complex which is essential for maintaining genomic stability. The MutSα complex where MSH6 pairs with MSH2 operates along with other proteins in the MMR pathway to correct DNA replication errors. MSH6 is also known to interact with PCNA a DNA polymerase processivity factor which facilitates its role in the repair process.

Pathways

MSH6 participates prominently in the DNA mismatch repair pathway. This pathway is critical for correcting DNA errors and preventing mutations during replication. In association with MLH1-PMS2 (MutLα complex) MSH6 ensures that DNA integrity is preserved. Additionally MSH6 is involved in the base excision repair (BER) pathway where it collaborates with other repair proteins to fix small base lesions.

MSH6 has a significant connection with Lynch syndrome also known as hereditary nonpolyposis colorectal cancer (HNPCC). This condition is characterized by germline mutations in MMR genes including MSH6 leading to increased cancer risk particularly in the colon. Moreover alterations in MSH6 can contribute to microsatellite instability a feature seen in certain types of endometrial cancer. Mutations in MSH2 often accompany MSH6 mutations in these disorders further impacting the MMR pathway's efficiency.

Specifications

Form

Liquid

General info

Function

Component of the post-replicative DNA mismatch repair system (MMR). Heterodimerizes with MSH2 to form MutS alpha, which binds to DNA mismatches thereby initiating DNA repair. When bound, MutS alpha bends the DNA helix and shields approximately 20 base pairs, and recognizes single base mismatches and dinucleotide insertion-deletion loops (IDL) in the DNA. After mismatch binding, forms a ternary complex with the MutL alpha heterodimer, which is thought to be responsible for directing the downstream MMR events, including strand discrimination, excision, and resynthesis. ATP binding and hydrolysis play a pivotal role in mismatch repair functions. The ATPase activity associated with MutS alpha regulates binding similar to a molecular switch : mismatched DNA provokes ADP-->ATP exchange, resulting in a discernible conformational transition that converts MutS alpha into a sliding clamp capable of hydrolysis-independent diffusion along the DNA backbone. This transition is crucial for mismatch repair. MutS alpha may also play a role in DNA homologous recombination repair. Recruited on chromatin in G1 and early S phase via its PWWP domain that specifically binds trimethylated 'Lys-36' of histone H3 (H3K36me3) : early recruitment to chromatin to be replicated allowing a quick identification of mismatch repair to initiate the DNA mismatch repair reaction.

Sequence similarities

Belongs to the DNA mismatch repair MutS family.

Post-translational modifications

The N-terminus is blocked.. Phosphorylated by PRKCZ, which may prevent MutS alpha degradation by the ubiquitin-proteasome pathway.

Subcellular localisation

Nucleus

Product protocols

Target data

Component of the post-replicative DNA mismatch repair system (MMR). Heterodimerizes with MSH2 to form MutS alpha, which binds to DNA mismatches thereby initiating DNA repair. When bound, MutS alpha bends the DNA helix and shields approximately 20 base pairs, and recognizes single base mismatches and dinucleotide insertion-deletion loops (IDL) in the DNA. After mismatch binding, forms a ternary complex with the MutL alpha heterodimer, which is thought to be responsible for directing the downstream MMR events, including strand discrimination, excision, and resynthesis. ATP binding and hydrolysis play a pivotal role in mismatch repair functions. The ATPase activity associated with MutS alpha regulates binding similar to a molecular switch : mismatched DNA provokes ADP-->ATP exchange, resulting in a discernible conformational transition that converts MutS alpha into a sliding clamp capable of hydrolysis-independent diffusion along the DNA backbone. This transition is crucial for mismatch repair. MutS alpha may also play a role in DNA homologous recombination repair. Recruited on chromatin in G1 and early S phase via its PWWP domain that specifically binds trimethylated 'Lys-36' of histone H3 (H3K36me3) : early recruitment to chromatin to be replicated allowing a quick identification of mismatch repair to initiate the DNA mismatch repair reaction.
See full target information MSH6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com