JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB99390

Recombinant Human MTH1 protein

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant Human MTH1 protein is a Human Full Length protein, in the 1 to 156 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

MTH1, NUDT1, Oxidized purine nucleoside triphosphate hydrolase, 2-hydroxy-dATP diphosphatase, 8-oxo-dGTPase, Methylated purine nucleoside triphosphate hydrolase, Nucleoside diphosphate-linked moiety X motif 1, Nudix motif 1

1 Images
SDS-PAGE - Recombinant Human MTH1 protein (AB99390)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human MTH1 protein (AB99390)

15% SDS-PAGE analysis of 3μg ab99390.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P36639

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0308% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV","proteinLength":"Full Length","predictedMolecularWeight":"20.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":156,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P36639","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The target MTH1 also known as NUDT1 or karonudib is a protein with a mass of approximately 18.5 kDa. This protein belongs to the Nudix hydrolase family and is expressed in various tissues including liver brain and pancreas. Mechanically MTH1 plays a role in hydrolyzing oxidized nucleotides like 8-oxo-dGTP and 2-OH-dATP preventing their incorporation into DNA and maintaining genomic integrity.
Biological function summary

MTH1 prevents the incorporation of oxidized purine nucleotides into DNA. Without MTH1 cells risk mutations that can lead to genomic instability. The protein does not form part of a larger complex but acts independently. MTH1 functions are particularly relevant in cell types with high oxidative stress or rapidly dividing cells where its activity helps to protect against oxidative damage.

Pathways

MTH1 fits into DNA repair and antioxidant defense systems. It is notably involved in pathways managing oxidative stress damage. MTH1 works alongside other proteins like superoxide dismutase and catalase contributing to the detoxification of reactive oxygen species ultimately protecting the DNA repair machinery from oxidative damage.

MTH1 relates to cancer and neurodegenerative diseases. High MTH1 activity can be seen in cancer cells as these cells depend on MTH1 to prevent DNA damage from oxidative stress. In this context MTH1 pairs up with proteins like p53 which also has a role in maintaining genomic stability. In neurodegenerative diseases such as Parkinson's oxidative stress plays an important role implicating MTH1 since it mitigates oxidative nucleotide damage that might worsen neuronal damage.

Specifications

Form

Liquid

Additional notes

ab99390 is purified using conventional chromatography techniques.

General info

Function

Oxidized purine nucleoside triphosphate hydrolase which is a prominent sanitizer of the oxidized nucleotide pool (PubMed : 10608900, PubMed : 12857738, PubMed : 22556419, PubMed : 24695224, PubMed : 24695225, PubMed : 26238318, PubMed : 28679043, PubMed : 7713500, PubMed : 8226881). Catalyzes the hydrolysis of 2-oxo-dATP (2-hydroxy-dATP) into 2-oxo-dAMP (PubMed : 10373420). Has also a significant hydrolase activity toward 2-oxo-ATP, 8-oxo-dGTP and 8-oxo-dATP (PubMed : 10373420, PubMed : 11139615). Through the hydrolysis of oxidized purine nucleoside triphosphates, prevents their incorporation into DNA and the subsequent transversions A : T to C : G and G : C to T : A (PubMed : 10373420, PubMed : 10608900, PubMed : 11756418, PubMed : 12857738, PubMed : 16607562, PubMed : 24695224, PubMed : 24695225, PubMed : 26999531, PubMed : 28035004, PubMed : 8226881). Also catalyzes the hydrolysis of methylated purine nucleoside triphosphate preventing their integration into DNA (PubMed : 30304478, PubMed : 32144205). Through this antimutagenic activity protects cells from oxidative stress (PubMed : 10608900, PubMed : 12857738, PubMed : 24695224, PubMed : 24695225, PubMed : 30304478, PubMed : 32144205, PubMed : 7713500, PubMed : 8226881).

Sequence similarities

Belongs to the Nudix hydrolase family.

Post-translational modifications

The N-terminus is blocked.

Subcellular localisation

Mitochondrion matrix

Product protocols

Target data

Oxidized purine nucleoside triphosphate hydrolase which is a prominent sanitizer of the oxidized nucleotide pool (PubMed : 10608900, PubMed : 12857738, PubMed : 22556419, PubMed : 24695224, PubMed : 24695225, PubMed : 26238318, PubMed : 28679043, PubMed : 7713500, PubMed : 8226881). Catalyzes the hydrolysis of 2-oxo-dATP (2-hydroxy-dATP) into 2-oxo-dAMP (PubMed : 10373420). Has also a significant hydrolase activity toward 2-oxo-ATP, 8-oxo-dGTP and 8-oxo-dATP (PubMed : 10373420, PubMed : 11139615). Through the hydrolysis of oxidized purine nucleoside triphosphates, prevents their incorporation into DNA and the subsequent transversions A : T to C : G and G : C to T : A (PubMed : 10373420, PubMed : 10608900, PubMed : 11756418, PubMed : 12857738, PubMed : 16607562, PubMed : 24695224, PubMed : 24695225, PubMed : 26999531, PubMed : 28035004, PubMed : 8226881). Also catalyzes the hydrolysis of methylated purine nucleoside triphosphate preventing their integration into DNA (PubMed : 30304478, PubMed : 32144205). Through this antimutagenic activity protects cells from oxidative stress (PubMed : 10608900, PubMed : 12857738, PubMed : 24695224, PubMed : 24695225, PubMed : 30304478, PubMed : 32144205, PubMed : 7713500, PubMed : 8226881).
See full target information NUDT1

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Molecular cancer therapeutics 19:432-446 PubMed31744893

2019

The Existence of MTH1-independent 8-oxodGTPase Activity in Cancer Cells as a Compensatory Mechanism against On-target Effects of MTH1 Inhibitors.

Applications

Unspecified application

Species

Unspecified reactive species

Govindi J Samaranayake,Clara I Troccoli,Ling Zhang,Mai Huynh,Christina J Jayaraj,Debin Ji,Lisa McPherson,Yoshiyuki Onishi,Dao M Nguyen,David J Robbins,Mahsa Karbaschi,Marcus S Cooke,Antonio Barrientos,Eric T Kool,Priyamvada Rai

DNA repair 83:102644 PubMed31311767

2019

Increased MTH1-specific 8-oxodGTPase activity is a hallmark of cancer in colon, lung and pancreatic tissue.

Applications

Unspecified application

Species

Unspecified reactive species

Lisa A McPherson,Clara I Troccoli,Debin Ji,Annie E Bowles,Makelle L Gardiner,Michael G Mohsen,Nagaraj S Nagathihalli,Dao M Nguyen,David J Robbins,Nipun B Merchant,Eric T Kool,Priyamvada Rai,James M Ford
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com