JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB196074

Recombinant human mTOR + MLST8 + Raptor protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human mTOR + MLST8 + Raptor protein is a Human Fragment protein, in the 1362 to 2549 aa range, expressed in Baculovirus infected Sf9 cells, with >50%, suitable for SDS-PAGE, FuncS.

View Alternative Names

FRAP, FRAP1, FRAP2, RAFT1, RAPT1, MTOR, Serine/threonine-protein kinase mTOR, FK506-binding protein 12-rapamycin complex-associated protein 1, FKBP12-rapamycin complex-associated protein, Mammalian target of rapamycin, Mechanistic target of rapamycin, Rapamycin and FKBP12 target 1, Rapamycin target protein 1, mTOR

2 Images
Functional Studies - Recombinant human mTOR + MLST8 + Raptor protein (AB196074)
  • FuncS

Supplier Data

Functional Studies - Recombinant human mTOR + MLST8 + Raptor protein (AB196074)

Activity assay using ab196074.

SDS-PAGE - Recombinant human mTOR + MLST8 + Raptor protein (AB196074)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human mTOR + MLST8 + Raptor protein (AB196074)

10% SDS-PAGE analysis of 3 μg ab196074 with Coomassie staining.

Key facts

Purity

>50% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific Activity: 7.1pmol/min/μg.

Enzyme reaction is conducted in a buffer containing 50 mM HEPES (pH 7.5), 10 mM MgCl2, 1 mM EGTA, 200 μM ATP, 0.01% Brij-35 and 2 μM substrate at room temperature for 1 hour.

Accession

P42345

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.72% Sodium chloride, 0.71% Tris HCl, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Complex of Human mTOR (GenBank Accession No. NM_004958), a.a. 1362-end, with N-terminal DDDDK tag, Human MLST8 (GenBank Accession No. NM_022372), a.a. 2-326 (end) with N-terminal His tag, and Human Raptor (GenBank Accession No. NM_020761), a.a. 2-1335 (end) with N-terminal His tag, co-expressed in a Baculovirus-infected Sf9 cell expression system.

Sequence info

[{"sequence":"EFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW","proteinLength":"Fragment","predictedMolecularWeight":"137 kDa","actualMolecularWeight":null,"aminoAcidEnd":2549,"aminoAcidStart":1362,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P42345","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]},{"sequence":"ESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSVSSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILSFETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYKATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR","proteinLength":"Full Length","predictedMolecularWeight":"150 kDa","actualMolecularWeight":null,"aminoAcidEnd":1335,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q8N122","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"NTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG","proteinLength":"Full Length","predictedMolecularWeight":"37 kDa","actualMolecularWeight":null,"aminoAcidEnd":326,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q9BVC4","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The mTOR MLST8 and Raptor proteins together form a complex known as the mTORC1 complex. mTOR also called the mechanistic Target of Rapamycin is a serine/threonine kinase with a mass of about 289 kDa. It is expressed in various tissues including muscle liver and brain where it plays an important role in controlling cellular growth and metabolism. MLST8 also sometimes known as GβL is a regulatory binding partner within this complex. Raptor an adaptor protein assists the assembly of mTORC1 thereby facilitating its recruitment to substrates.
Biological function summary

The mTORC1 complex regulates processes of cell growth proliferation and autophagy in response to nutrient signals. mTORC1 integrates inputs from upstream growth factors and amino acid levels to influence cell cycle progression and protein synthesis. The complex localizes to the lysosomal surface where it becomes activated. This activation allows mTORC1 to control anabolic pathways ensuring that cells can increase their mass and function optimally in response to environmental cues.

Pathways

MTORC1 interacts with the PI3K/AKT signaling pathway which is essential for controlling metabolism and cellular survival. This pathway involves proteins such as AKT and TSC2 which serve as regulators of mTORC1 activity. Additionally mTORC1 influences the AMPK pathway which balances energy expenditure with availability. Through these interactions mTORC1 serves as a pivotal node that integrates nutrient and energy signals to coordinate cell growth and division.

The mTORC1 complex exhibits a significant connection to cancer and metabolic disorders. Dysregulation of mTORC1 activity often through mutations in related proteins such as PTEN contributes to uncontrolled cell proliferation and tumor formation. Moreover abnormal mTORC1 signaling can affect insulin sensitivity linking it to metabolic syndromes like diabetes. Understanding and targeting this complex holds therapeutic potential for these disorders as it touches upon key aspects of cellular metabolism and growth control.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

The protein expressed by the MTOR gene is a serine/threonine protein kinase that serves as a central regulator of cellular metabolism, growth, and survival in response to various signals, such as hormones and nutrients. MTOR operates within two distinct signaling complexes, mTORC1 and mTORC2. mTORC1 is activated to upregulate protein synthesis by phosphorylating regulators of mRNA translation and ribosome synthesis, and phosphorylates and activates proteins like RPS6KB1 and RPS6KB2 to promote protein synthesis. It controls MiT/TFE factors TFEB and TFE3 by mediating their retention and inactivation under nutrient-rich conditions, and it inhibits autophagy by phosphorylating DAP and RUBCNL/Pacer. Additionally, mTORC1 engages in feedback control on growth factor signaling and may influence microtubules through CLIP1 phosphorylation. The mTORC2 complex may regulate cellular processes, including survival and cytoskeletal organization, by phosphorylating AKT1 and regulating the actin cytoskeleton via PRKCA, PXN, and Rho-type guanine nucleotide exchange factors. It also regulates the phosphorylation of SGK1. This supplementary information is collated from multiple sources and compiled automatically.

Sequence similarities

Belongs to the PI3/PI4-kinase family.

Post-translational modifications

Autophosphorylates when part of mTORC1 or mTORC2 (PubMed:15467718, PubMed:9434772). Phosphorylation at Ser-1261, Ser-2159 and Thr-2164 promotes autophosphorylation (PubMed:19487463). Phosphorylation in the kinase domain modulates the interactions of MTOR with RPTOR and AKT1S1/PRAS40 and leads to increased intrinsic mTORC1 kinase activity (PubMed:15905173, PubMed:19145465, PubMed:21576368). Phosphorylation at Ser-2159 by TBK1 in response to growth factors and pathogen recognition receptors promotes mTORC1 activity (PubMed:29150432). Phosphorylation at Thr-2173 in the ATP-binding region by AKT1 strongly reduces kinase activity (PubMed:24247430).

Subcellular localisation

Mitochondrion outer membrane

Product protocols

Target data

The protein expressed by the MTOR gene is a serine/threonine protein kinase that serves as a central regulator of cellular metabolism, growth, and survival in response to various signals, such as hormones and nutrients. MTOR operates within two distinct signaling complexes, mTORC1 and mTORC2. mTORC1 is activated to upregulate protein synthesis by phosphorylating regulators of mRNA translation and ribosome synthesis, and phosphorylates and activates proteins like RPS6KB1 and RPS6KB2 to promote protein synthesis. It controls MiT/TFE factors TFEB and TFE3 by mediating their retention and inactivation under nutrient-rich conditions, and it inhibits autophagy by phosphorylating DAP and RUBCNL/Pacer. Additionally, mTORC1 engages in feedback control on growth factor signaling and may influence microtubules through CLIP1 phosphorylation. The mTORC2 complex may regulate cellular processes, including survival and cytoskeletal organization, by phosphorylating AKT1 and regulating the actin cytoskeleton via PRKCA, PXN, and Rho-type guanine nucleotide exchange factors. It also regulates the phosphorylation of SGK1. This supplementary information is collated from multiple sources and compiled automatically.
See full target information MTOR

Additional targets

RPTOR,MLST8

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com