JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB103784

Recombinant Human mtTFA protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human mtTFA protein is a Human Full Length protein, in the 43 to 246 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

TCF6, TCF6L2, TFAM, mtTFA, Mitochondrial transcription factor 1, Transcription factor 6, Transcription factor 6-like 2, MtTF1, TCF-6

1 Images
SDS-PAGE - Recombinant Human mtTFA protein (AB103784)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human mtTFA protein (AB103784)

15% SDS-PAGE analysis of 3μg ab103784.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q00059

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC","proteinLength":"Full Length","predictedMolecularWeight":"26.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":246,"aminoAcidStart":43,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q00059","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MtTFA also known as mitochondrial transcription factor A or TFAM is an important element in mitochondrial DNA regulation. It plays a pivotal role in maintaining mitochondrial genome integrity and ensuring proper mitochondrial function. This protein weighing approximately 25 kDa is expressed within the mitochondria. It binds to the mitochondrial DNA facilitating the transcription and replication processes ensuring the correct functioning of cellular energy metabolism.
Biological function summary

MtTFA is essential for mitochondrial DNA packaging and transcriptional activation. It acts as a binding factor that organizes the mtDNA into a nucleoid-like structure providing protection and stability. MtTFA functions as part of a larger multi-protein complex that includes mitochondrial RNA polymerase ensuring proper transcription of mitochondrial genes. These activities are critical for normal energy production and mitochondrial biogenesis.

Pathways

The mtTFA protein is integral to the oxidative phosphorylation and mitochondrial biogenesis pathways. It orchestrates the expression of genes critical for these pathways alongside related proteins like NRF2 and PGC-1α. MtTFA ensures effective mitochondrial function by modulating the transcription of key mitochondrial-encoded components necessary for electron transport and ATP synthesis thereby sustaining cellular energy balance.

MtTFA dysregulation is associated with mitochondrial diseases and neurodegenerative disorders. Abnormal mtTFA activity disrupts mitochondrial DNA maintenance potentially leading to conditions like mitochondrial myopathy. It is also linked with proteins such as POLG which are involved in mitochondrial DNA replication. Understanding mtTFA's role in these pathologies highlights its importance as a target in therapeutic strategies aimed at restoring mitochondrial function and preventing disease progression.

Specifications

Form

Liquid

Additional notes

ab103784 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

Binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation (PubMed : 29445193, PubMed : 32183942). Component of the mitochondrial transcription initiation complex, composed at least of TFB2M, TFAM and POLRMT that is required for basal transcription of mitochondrial DNA (PubMed : 29149603). In this complex, TFAM recruits POLRMT to a specific promoter whereas TFB2M induces structural changes in POLRMT to enable promoter opening and trapping of the DNA non-template strand (PubMed : 20410300). Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase (PubMed : 22037172). Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites (PubMed : 22037172). Is able to unwind DNA (PubMed : 22037172). Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes (PubMed : 1737790). Required for maintenance of normal levels of mitochondrial DNA (PubMed : 19304746, PubMed : 22841477). May play a role in organizing and compacting mitochondrial DNA (PubMed : 22037171).

Post-translational modifications

Phosphorylation by PKA within the HMG box 1 impairs DNA binding and promotes degradation by the AAA+ Lon protease.

Subcellular localisation

Mitochondrion

Product protocols

Target data

Binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation (PubMed : 29445193, PubMed : 32183942). Component of the mitochondrial transcription initiation complex, composed at least of TFB2M, TFAM and POLRMT that is required for basal transcription of mitochondrial DNA (PubMed : 29149603). In this complex, TFAM recruits POLRMT to a specific promoter whereas TFB2M induces structural changes in POLRMT to enable promoter opening and trapping of the DNA non-template strand (PubMed : 20410300). Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase (PubMed : 22037172). Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites (PubMed : 22037172). Is able to unwind DNA (PubMed : 22037172). Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes (PubMed : 1737790). Required for maintenance of normal levels of mitochondrial DNA (PubMed : 19304746, PubMed : 22841477). May play a role in organizing and compacting mitochondrial DNA (PubMed : 22037171).
See full target information TFAM

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

EMBO molecular medicine 15:e16581 PubMed36629048

2023

LONP1 targets HMGCS2 to protect mitochondrial function and attenuate chronic kidney disease.

Applications

Unspecified application

Species

Unspecified reactive species

Mi Bai,Mengqiu Wu,Mingzhu Jiang,Jia He,Xu Deng,Shuang Xu,Jiaojiao Fan,Mengqiu Miao,Ting Wang,Yuting Li,Xiaowen Yu,Lin Wang,Yue Zhang,Songming Huang,Li Yang,Zhanjun Jia,Aihua Zhang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com