JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114217

Recombinant Human MyD88 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MyD88 protein is a Human Fragment protein, in the 31 to 130 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Myeloid differentiation primary response protein MyD88, MYD88

1 Images
SDS-PAGE - Recombinant Human MyD88 protein (AB114217)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human MyD88 protein (AB114217)

ab114217 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

Q99836

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"RRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQ","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":130,"aminoAcidStart":31,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q99836","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MyD88 standing for myeloid differentiation primary response 88 is a cytoplasmic adaptor protein with a molecular weight of approximately 33 kDa. This protein is expressed widely in immune cells including monocytes macrophages and dendritic cells. MyD88 serves a major role in the signaling pathways for the innate immune system. It acts as a linker transmitting signals from toll-like receptors (TLRs) and interleukin-1 receptors (IL-1Rs) to downstream signaling molecules ultimately activating transcription factors.
Biological function summary

MyD88 plays a significant role in mediating immune responses by forming part of a complex that includes IRAK kinases and TRAF6. When TLRs or IL-1Rs activate MyD88 this adaptor protein recruits IRAK4 which then phosphorylates IRAK1 or IRAK2. This cascade promotes the activation of NF-κB and MAPK pathways leading to the production of inflammatory cytokines. The MyD88-dependent pathway is integral to innate immunity influencing how the body responds to pathogen infection and inflammation.

Pathways

MyD88 integrates into both the TLR signaling and IL-1R signaling pathways. Key related proteins in these pathways include interleukin-1 receptor-associated kinase (IRAK) and tumor necrosis factor receptor-associated factor 6 (TRAF6). MyD88 initiates the recruitment and activation of IRAK1 and IRAK4 following receptor engagement leading to subsequent activation of downstream signals. As part of these pathways MyD88 mediates cellular responses important for immune system signaling and inflammatory response regulation.

MyD88 involvement is notable in the context of oncological and autoimmune diseases. Mutations or dysregulation of MyD88 are implicated in conditions like lymphoma and rheumatoid arthritis. In lymphoma the mutation usually results in constant activation of NF-κB leading to unchecked cell growth. As for rheumatoid arthritis an overactive immune response due to MyD88 can cause additional inflammation affecting joint tissues. In these conditions MyD88 interaction with IRAK4 is significant given their mutual role in immune and inflammatory pathways.

Specifications

Form

Liquid

General info

Function

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response (PubMed : 15361868, PubMed : 18292575, PubMed : 33718825, PubMed : 37971847). Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed : 15361868, PubMed : 19506249, PubMed : 24316379). Increases IL-8 transcription (PubMed : 9013863). Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes. Upon TLR8 activation by GU-rich single-stranded RNA (GU-rich RNA) derived from viruses such as SARS-CoV-2, SARS-CoV and HIV-1, induces IL1B release through NLRP3 inflammasome activation (PubMed : 33718825). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).

Post-translational modifications

Ubiquitinated; undergoes 'Lys-63'-linked polyubiquitination. OTUD4 specifically hydrolyzes 'Lys-63'-linked polyubiquitinated MYD88 (PubMed:29395066). Deubiquitinated by USP3 that cleaves 'Lys-63'-linked ubiquitin chains leading to inhibition of MYD88-induced NF-kappa-B signaling (PubMed:37971847).. (Microbial infection) Ubiquitinated by human herpesvirus 8 (KSHV) protein RTA/ORF50, leading to proteasomal degradation ans suppression of TLR4 signaling pathway.

Subcellular localisation

Nucleus

Product protocols

Target data

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response (PubMed : 15361868, PubMed : 18292575, PubMed : 33718825, PubMed : 37971847). Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed : 15361868, PubMed : 19506249, PubMed : 24316379). Increases IL-8 transcription (PubMed : 9013863). Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes. Upon TLR8 activation by GU-rich single-stranded RNA (GU-rich RNA) derived from viruses such as SARS-CoV-2, SARS-CoV and HIV-1, induces IL1B release through NLRP3 inflammasome activation (PubMed : 33718825). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the expression of the antimicrobial lectin REG3G in the small intestine (By similarity).
See full target information MYD88

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com