JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114244

Recombinant Human Myogenin protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Myogenin protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 224 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

BHLHC3, MYF4, MYOG, Myogenin, Class C basic helix-loop-helix protein 3, Myogenic factor 4, bHLHc3, Myf-4

1 Images
SDS-PAGE - Recombinant Human Myogenin protein (GST tag N-Terminus) (AB114244)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Myogenin protein (GST tag N-Terminus) (AB114244)

12.5% SDS-PAGE showing ab114244 at approximately 50.75kDa stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

P15173

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein).</p>" } } }

Sequence info

[{"sequence":"MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN","proteinLength":"Full Length","predictedMolecularWeight":"50.75 kDa","actualMolecularWeight":null,"aminoAcidEnd":224,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P15173","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Myogenin also known as MYOG is a muscle-specific transcription factor that plays an important role in the regulation of muscle differentiation and development. It belongs to the MyoD family of basic helix-loop-helix proteins. Myogenin has a molecular weight of approximately 34 to 39 kDa. It is typically expressed in skeletal muscle tissues aiding in the transition from proliferating myoblasts to differentiated myotubes. Immunohistochemistry (IHC) methods often use myogenin antibodies like the 'myogenin anticuerpo' and 'F5D' to identify myogenin expression within tissue samples facilitating the understanding of muscle tissue organization and development.
Biological function summary

Myogenin functions in controlling the transcription of muscle-specific genes that are essential during myogenesis. This transcription factor forms heterodimers with E-proteins becoming part of DNA-binding complexes that activate the transcription of muscle-specific genes. Myogenin's presence is critical during muscle cell fusion and maturation signifying its importance in proper muscle tissue formation and maintenance. Myogenin staining is often used as a technique to study muscle differentiation in various experimental settings.

Pathways

Myogenin is integrated into the myogenic regulatory network where it activates genes involved in muscle fiber maturation. It participates in the MyoD regulatory pathway working alongside other myogenic regulatory factors like MyoD Myf5 and MRF4. These proteins create a coordinated network ensuring efficient muscle cell differentiation and growth. The cross-talk between myogenin and these factors highlights its role in the intricate web of gene regulation necessary for muscle development.

The altered expression or mutation of the myogenin gene has potential implications in muscular dystrophies and myopathies. For instance disruptions in myogenin activity can lead to impaired muscle repair and regeneration contributing to the pathology of conditions such as rhabdomyosarcoma. Within these contexts myogenin associates with other proteins like MyoD whose expression might also be altered further accentuating the disruption in normal muscle differentiation processes during disease states.

Specifications

Form

Liquid

General info

Function

Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation, cell cycle exit and muscle atrophy. Essential for the development of functional embryonic skeletal fiber muscle differentiation. However is dispensable for postnatal skeletal muscle growth; phosphorylation by CAMK2G inhibits its transcriptional activity in respons to muscle activity. Required for the recruitment of the FACT complex to muscle-specific promoter regions, thus promoting gene expression initiation. During terminal myoblast differentiation, plays a role as a strong activator of transcription at loci with an open chromatin structure previously initiated by MYOD1. Together with MYF5 and MYOD1, co-occupies muscle-specific gene promoter core regions during myogenesis. Also cooperates with myocyte-specific enhancer factor MEF2D and BRG1-dependent recruitment of SWI/SNF chromatin-remodeling enzymes to alter chromatin structure at myogenic late gene promoters. Facilitates cell cycle exit during terminal muscle differentiation through the up-regulation of miR-20a expression, which in turn represses genes involved in cell cycle progression. Binds to the E-box containing (E1) promoter region of the miR-20a gene. Also plays a role in preventing reversal of muscle cell differentiation. Contributes to the atrophy-related gene expression in adult denervated muscles. Induces fibroblasts to differentiate into myoblasts (By similarity).

Post-translational modifications

Phosphorylated by CAMK2G on threonine and serine amino acids in a muscle activity-dependent manner. Phosphorylation of Thr-87 impairs both DNA-binding and trans-activation functions in contracting muscles (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation, cell cycle exit and muscle atrophy. Essential for the development of functional embryonic skeletal fiber muscle differentiation. However is dispensable for postnatal skeletal muscle growth; phosphorylation by CAMK2G inhibits its transcriptional activity in respons to muscle activity. Required for the recruitment of the FACT complex to muscle-specific promoter regions, thus promoting gene expression initiation. During terminal myoblast differentiation, plays a role as a strong activator of transcription at loci with an open chromatin structure previously initiated by MYOD1. Together with MYF5 and MYOD1, co-occupies muscle-specific gene promoter core regions during myogenesis. Also cooperates with myocyte-specific enhancer factor MEF2D and BRG1-dependent recruitment of SWI/SNF chromatin-remodeling enzymes to alter chromatin structure at myogenic late gene promoters. Facilitates cell cycle exit during terminal muscle differentiation through the up-regulation of miR-20a expression, which in turn represses genes involved in cell cycle progression. Binds to the E-box containing (E1) promoter region of the miR-20a gene. Also plays a role in preventing reversal of muscle cell differentiation. Contributes to the atrophy-related gene expression in adult denervated muscles. Induces fibroblasts to differentiate into myoblasts (By similarity).
See full target information MYOG

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com