JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB79185

Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 166 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, WB.

View Alternative Names

MLC2, MYL2, MLC-2, MLC-2v, Cardiac myosin light chain 2, Ventricular myosin light chain 2, MLC-2s/v

3 Images
Western blot - Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus) (AB79185)
  • WB

Unknown

Western blot - Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus) (AB79185)

All lanes:

Western blot - Anti-Myosin Light Chain 2 antibody [EPR3741] (<a href='/en-us/products/primary-antibodies/myosin-light-chain-2-antibody-epr3741-ab92721'>ab92721</a>) at 1/10000 dilution

Lane 1:

Western blot - Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus) (ab79185) at 0.1 µg

Lane 2:

Western blot - Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus) (ab79185) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 19 kDa

true

Exposure time: 8min

Western blot - Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus) (AB79185)
  • WB

Unknown

Western blot - Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus) (AB79185)

All lanes:

Western blot - Anti-Myosin Light Chain 2 antibody [EPR3741] (<a href='/en-us/products/primary-antibodies/myosin-light-chain-2-antibody-epr3741-ab92721'>ab92721</a>) at 1/10000 dilution

Lane 1:

Western blot - Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus) (ab79185) at 0.1 µg

Lane 2:

Western blot - Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus) (ab79185) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 19 kDa

true

Exposure time: 4min

SDS-PAGE - Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus) (AB79185)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Myosin Light Chain 2 protein (His tag N-Terminus) (AB79185)

15% SDS-PAGE showing ab79185 at approximately 21kDa (3μg).

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

WB, SDS-PAGE

applications

Biologically active

No

Accession

P10916

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 0.242% Tris, 0.0555% Calcium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab79185 can be used as a WB positive control in conjunction with <a href='/en-us/products/primary-antibodies/myosin-light-chain-2-antibody-epr3741-ab92721'>ab92721</a>.</p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD","proteinLength":"Full Length","predictedMolecularWeight":"20.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":166,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P10916","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Myosin Light Chain 2 (MLC2) also known as ventricular myosin regulatory light chain (MLC2v) or smooth muscle myosin light chain is a critical component of the myosin protein complex. It is a low-molecular-weight protein with a mass typically around 20 kDa. Myosin Light Chain 2 plays a mechanical role in muscle contraction where it interacts with myosin heavy chain and actin filaments. This interaction modulates muscle contraction in both cardiac and smooth muscle tissues. MLC2 is ubiquitously expressed in muscles but exhibits specific expression patterns in cardiac and smooth muscles.
Biological function summary

Myosin Light Chain 2 plays a fundamental role in muscle function by regulating myofilament sensitivity to calcium ions. It functions as part of the myosin complex which is essential for actin-myosin interactions required for muscle contraction. Phosphorylation of MLC2 alters the actomyosin activity affecting muscle contraction strength and speed. This regulation contributes significantly to muscle tone contractility and overall heart function.

Pathways

Myosin Light Chain 2 is a pivotal player in the calcium signaling and smooth muscle contraction pathways. Within these pathways phosphorylation leads to myosin cross-bridge cycling with actin facilitated by proteins like calmodulin and myosin light chain kinase (MLCK). This biochemical interaction not only underpins smooth muscle function but also plays roles in other processes like cell motility and division emphasizing MLC2's versatility in cellular mechanics.

Aberrations in Myosin Light Chain 2 function or expression implicate it in cardiac hypertrophy and certain smooth muscle dysfunctions such as hypertension. Changes in MLC2 phosphorylation state can directly affect cardiac contractility worsening conditions like hypertrophic cardiomyopathy. It also relates closely with other proteins such as MLCK and calmodulin which are involved in these disease pathways highlighting a complex network of regulatory mechanisms that when disrupted can lead to severe health issues.

Specifications

Form

Liquid

Additional notes

ab79185 is purified using conventional chromatography techniques.

General info

Function

Contractile protein that plays a role in heart development and function (PubMed : 23365102, PubMed : 32453731). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity).

Post-translational modifications

N-terminus is methylated by METTL11A/NTM1.. Phosphorylated by MYLK3 and MYLK2; promotes cardiac muscle contraction and function (By similarity). Dephosphorylated by PPP1CB complexed to PPP1R12B (By similarity). The phosphorylated form in adult is expressed as gradients across the heart from endocardium (low phosphorylation) to epicardium (high phosphorylation); regulates cardiac torsion and workload distribution (By similarity).

Product protocols

Target data

Contractile protein that plays a role in heart development and function (PubMed : 23365102, PubMed : 32453731). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity).
See full target information MYL2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com