JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB103504

Recombinant Human N myc interactor/NMI protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human N myc interactor/NMI protein is a Human Full Length protein, in the 1 to 307 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

N-myc-interactor, Nmi, N-myc and STAT interactor, NMI

1 Images
SDS-PAGE - Recombinant Human N myc interactor/NMI protein (AB103504)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human N myc interactor/NMI protein (AB103504)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q13287

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as N myc interactor

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINMEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPHIAYFEE","proteinLength":"Full Length","predictedMolecularWeight":"37.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":307,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q13287","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

N myc interactor often referred to as NMI interacts with members of the MYC family including N-MYC and C-MYC. Known as N-MYC and C-MYC interacting protein NMI has a molecular weight of approximately 54 kDa. NMI expresses in a variety of tissues with higher levels in brain and liver tissues. Its presence is also notable in immune cells pointing towards a complex role in cellular processes related to both developmental and immune responses.
Biological function summary

NMI collaborates with transcription factors to influence the regulation of gene expression. It plays a significant role in the formation of protein complexes that regulate transcriptional activities of oncogenes particularly through interaction with MYC and STAT proteins. NMI's ability to form complexes makes it a notable player in modulating signal transduction pathways. Its balancing act with transcription factors affects cell proliferation and differentiation critical components of its biological functionality.

Pathways

NMI has a significant impact on the JAK-STAT signaling pathway and the MYC-mediated transcription network. Within these pathways NMI modulates the activities of the MYC family of oncogenes and interacts with signal transducers and activators like STATs. These interactions contribute to the regulation of cellular processes such as growth and apoptosis. Such pathways illustrate NMI's role in maintaining cellular homeostasis and its interactive role with proteins like STAT and MYC.

NMI has been associated with cancer and autoimmune diseases. NMI's interaction with MYC oncogenes links it to various cancers particularly neuroblastoma. It also associates with autoimmune disorder mechanisms implicating its expression and regulation in immune-related pathologies. In cancer NMI's relationship with MYC affects tumor growth and progression illustrating its potential as a target for therapeutic intervention. Its involvement highlights the importance of understanding its function in disease pathways.

Specifications

Form

Liquid

Additional notes

purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

Acts as a signaling pathway regulator involved in innate immune system response (PubMed : 26342464, PubMed : 29038465, PubMed : 29350881, PubMed : 9989503). In response to interleukin 2/IL2 and interferon IFN-gamma/IFNG, interacts with signal transducer and activator of transcription/STAT which activate the transcription of downstream genes involved in a multitude of signals for development and homeostasis (PubMed : 29377960, PubMed : 9989503). Enhances the recruitment of CBP/p300 coactivators to STAT1 and STAT5, resulting in increased STAT1- and STAT5-dependent transcription (PubMed : 9989503). In response to interferon IFN-alpha, associates in a complex with signaling pathway regulator IFI35 to regulate immune response; the complex formation prevents proteasome-mediated degradation of IFI35 (PubMed : 10779520, PubMed : 10950963). In complex with IFI35, inhibits virus-triggered type I IFN-beta production when ubiquitinated by ubiquitin-protein ligase TRIM21 (PubMed : 26342464). In complex with IFI35, negatively regulates nuclear factor NF-kappa-B signaling by inhibiting the nuclear translocation, activation and transcription of NF-kappa-B subunit p65/RELA, resulting in the inhibition of endothelial cell proliferation, migration and re-endothelialization of injured arteries (PubMed : 29350881). Negatively regulates virus-triggered type I interferon/IFN production by inducing proteosome-dependent degradation of IRF7, a transcriptional regulator of type I IFN, thereby interfering with cellular antiviral responses (By similarity). Beside its role as an intracellular signaling pathway regulator, also functions extracellularly as damage-associated molecular patterns (DAMPs) to promote inflammation, when actively released by macrophage to the extracellular space during cell injury or pathogen invasion (PubMed : 29038465). Macrophage-secreted NMI activates NF-kappa-B signaling in adjacent macrophages through Toll-like receptor 4/TLR4 binding and activation, thereby inducing NF-kappa-B translocation from the cytoplasm into the nucleus which promotes the release of pro-inflammatory cytokines (PubMed : 29038465).

Sequence similarities

Belongs to the NMI family.

Post-translational modifications

Ubiquitinated. 'Lys-63'-linked ubiquitination by TRIM21 promotes interaction with IFI35 and inhibits virus-triggered type I IFN-beta production.

Subcellular localisation

Nucleus

Product protocols

Target data

Acts as a signaling pathway regulator involved in innate immune system response (PubMed : 26342464, PubMed : 29038465, PubMed : 29350881, PubMed : 9989503). In response to interleukin 2/IL2 and interferon IFN-gamma/IFNG, interacts with signal transducer and activator of transcription/STAT which activate the transcription of downstream genes involved in a multitude of signals for development and homeostasis (PubMed : 29377960, PubMed : 9989503). Enhances the recruitment of CBP/p300 coactivators to STAT1 and STAT5, resulting in increased STAT1- and STAT5-dependent transcription (PubMed : 9989503). In response to interferon IFN-alpha, associates in a complex with signaling pathway regulator IFI35 to regulate immune response; the complex formation prevents proteasome-mediated degradation of IFI35 (PubMed : 10779520, PubMed : 10950963). In complex with IFI35, inhibits virus-triggered type I IFN-beta production when ubiquitinated by ubiquitin-protein ligase TRIM21 (PubMed : 26342464). In complex with IFI35, negatively regulates nuclear factor NF-kappa-B signaling by inhibiting the nuclear translocation, activation and transcription of NF-kappa-B subunit p65/RELA, resulting in the inhibition of endothelial cell proliferation, migration and re-endothelialization of injured arteries (PubMed : 29350881). Negatively regulates virus-triggered type I interferon/IFN production by inducing proteosome-dependent degradation of IRF7, a transcriptional regulator of type I IFN, thereby interfering with cellular antiviral responses (By similarity). Beside its role as an intracellular signaling pathway regulator, also functions extracellularly as damage-associated molecular patterns (DAMPs) to promote inflammation, when actively released by macrophage to the extracellular space during cell injury or pathogen invasion (PubMed : 29038465). Macrophage-secreted NMI activates NF-kappa-B signaling in adjacent macrophages through Toll-like receptor 4/TLR4 binding and activation, thereby inducing NF-kappa-B translocation from the cytoplasm into the nucleus which promotes the release of pro-inflammatory cytokines (PubMed : 29038465).
See full target information NMI

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com