JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB117213

Recombinant Human NAP1L1 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human NAP1L1 protein is a Human Full Length protein, in the 1 to 388 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

NRP, NAP1L1, Nucleosome assembly protein 1-like 1, NAP-1-related protein, hNRP

1 Images
SDS-PAGE - Recombinant Human NAP1L1 protein (AB117213)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human NAP1L1 protein (AB117213)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P55209

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAEC","proteinLength":"Full Length","predictedMolecularWeight":"47.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":388,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P55209","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NAP1L1 also known as Nucleosome Assembly Protein 1-Like 1 plays a role mechanically by assisting in nucleosome assembly. This protein has a mass of about 45 kDa and is expressed in various tissues including the brain and liver. NAP1L1 moves within the nucleus and cytoplasm which allows interaction with DNA and other proteins involved in chromatin organization.
Biological function summary

NAP1L1 contributes to chromatin remodeling by facilitating the assembly and disassembly of nucleosomes. NAP1L1 forms part of a complex that modulates chromatin structure and function influencing gene expression and DNA replication. It interacts with histones contributing to the deposition and removal of histones H2A and H2B making it essential for proper cell cycle progression and regulation.

Pathways

NAP1L1 acts in key signaling interconnected with chromatin modification and cell cycle control. It participates in the histone chaperone pathways influencing chromatin structure dynamics. NAP1L1 associates with proteins like histone H2A-H2B and the chromatin assembly factor CAF-1. These proteins collectively maintain chromatin integrity and regulation during DNA replication and repair processes.

NAP1L1 has links to certain cancers and neurological disorders. Increased levels of NAP1L1 are observable in some tumor types suggesting a role in cancer progression. In neurological contexts alterations in this protein are noted in conditions like Alzheimer's disease where chromatin misregulation is apparent. Connections with other proteins such as histone variants may further implicate NAP1L1 in these pathological states.

Specifications

Form

Liquid

Additional notes

ab117213 was purified using conventional chromatography

General info

Function

Histone chaperone that plays a role in the nuclear import of H2A-H2B and nucleosome assembly (PubMed : 20002496, PubMed : 21211722, PubMed : 26841755). Participates also in several important DNA repair mechanisms : greatly enhances ERCC6-mediated chromatin remodeling which is essential for transcription-coupled nucleotide excision DNA repair (PubMed : 28369616). Stimulates also homologous recombination (HR) by RAD51 and RAD54 which is essential in mitotic DNA double strand break (DSB) repair (PubMed : 24798879). Plays a key role in the regulation of embryonic neurogenesis (By similarity). Promotes the proliferation of neural progenitors and inhibits neuronal differentiation during cortical development (By similarity). Regulates neurogenesis via the modulation of RASSF10; regulates RASSF10 expression by promoting SETD1A-mediated H3K4 methylation at the RASSF10 promoter (By similarity).. (Microbial infection) Positively regulates Epstein-Barr virus reactivation in epithelial cells through the induction of viral BZLF1 expression.. (Microbial infection) Together with human herpesvirus 8 protein LANA1, assists the proper assembly of the nucleosome on the replicated viral DNA.

Sequence similarities

Belongs to the nucleosome assembly protein (NAP) family.

Post-translational modifications

Monoglycylated on glutamate residues. Cannot be polyglycylated due to the absence of functional TTLL10 in human (By similarity).. Polyglutamylated by TTLL4 on glutamate residues, resulting in polyglutamate chains on the gamma-carboxyl group. Both polyglutamylation and monoglycylation modifications can coexist on the same protein on adjacent residues, and lowering polyglycylation levels increases polyglutamylation, and reciprocally.

Subcellular localisation

Nucleus

Product protocols

Target data

Histone chaperone that plays a role in the nuclear import of H2A-H2B and nucleosome assembly (PubMed : 20002496, PubMed : 21211722, PubMed : 26841755). Participates also in several important DNA repair mechanisms : greatly enhances ERCC6-mediated chromatin remodeling which is essential for transcription-coupled nucleotide excision DNA repair (PubMed : 28369616). Stimulates also homologous recombination (HR) by RAD51 and RAD54 which is essential in mitotic DNA double strand break (DSB) repair (PubMed : 24798879). Plays a key role in the regulation of embryonic neurogenesis (By similarity). Promotes the proliferation of neural progenitors and inhibits neuronal differentiation during cortical development (By similarity). Regulates neurogenesis via the modulation of RASSF10; regulates RASSF10 expression by promoting SETD1A-mediated H3K4 methylation at the RASSF10 promoter (By similarity).. (Microbial infection) Positively regulates Epstein-Barr virus reactivation in epithelial cells through the induction of viral BZLF1 expression.. (Microbial infection) Together with human herpesvirus 8 protein LANA1, assists the proper assembly of the nucleosome on the replicated viral DNA.
See full target information NAP1L1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Cell chemical biology 26:1436-1449.e5 PubMed31447351

2019

Neutralization of the Positive Charges on Histone Tails by RNA Promotes an Open Chromatin Structure.

Applications

Unspecified application

Species

Unspecified reactive species

Rositsa Dueva,Karen Akopyan,Chiara Pederiva,Davide Trevisan,Soniya Dhanjal,Arne Lindqvist,Marianne Farnebo
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com