JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB123145

Recombinant Human NAT13 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NAT13 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 169 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

MAK3, NAT13, NAT5, NAA50, N-alpha-acetyltransferase 50, hNaa50p, N-acetyltransferase 13, N-acetyltransferase 5, N-acetyltransferase san homolog, N-epsilon-acetyltransferase 50, NatE catalytic subunit, hNAT5, hSAN

1 Images
SDS-PAGE - Recombinant Human NAT13 protein (His tag N-Terminus) (AB123145)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NAT13 protein (His tag N-Terminus) (AB123145)

15% SDS PAGE, 3 µg of ab123145 loaded.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9GZZ1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN","proteinLength":"Full Length","predictedMolecularWeight":"21.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":169,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9GZZ1","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The N-acetyltransferase 13 (NAT13) also known as GCN5-related N-acetyltransferase-like 3 is a protein involved in acetylation processes. It has a molecular mass of about 25 kDa. NAT13 is known for its specific role in the acetylation of polyamines important for cellular metabolism. This protein is expressed in various tissues with significant presence in the liver and kidney. The widespread expression suggests its importance in maintaining normal cellular function.
Biological function summary

NAT13 exerts its effects on cellular growth modulation and proliferation. NAT13 functions as a part of the enzyme complexes that regulate the acetylation process modifying substrates in the cell. This modification impacts protein function stability and interaction with other cellular components. NAT13's enzymatic activity influences cell cycle regulation and is critical for normal cell growth and division.

Pathways

NAT13 influences polyamine biosynthesis and metabolism which are necessary for cell replication and growth. One of the significant pathways involving NAT13 is the spermidine and spermine biosynthesis pathway which interacts with the polyamine oxidase enzyme. These interactions help to balance cellular growth signals and maintain cellular homeostasis. Another associated pathway is histone acetylation impacting gene expression regulation and being correlated with the GCN5 protein.

NAT13 has connections to colorectal cancer and hepatocellular carcinoma due to its role in cell cycle regulation and proliferation. Aberrant activity of NAT13 can disrupt normal acetylation patterns leading to uncontrolled cell growth associated with tumorigenesis. Additionally NAT13's dysregulation links with proteins such as c-Myc known for their part in oncogenic processes. Understanding NAT13's activity offers insights into the molecular mechanisms behind these cancers and potential therapeutic targets.

Specifications

Form

Liquid

Additional notes

ab123145 was purified using conventional chromatography.

General info

Function

N-alpha-acetyltransferase that acetylates the N-terminus of proteins that retain their initiating methionine (PubMed : 19744929, PubMed : 21900231, PubMed : 22311970, PubMed : 27484799). Has a broad substrate specificity : able to acetylate the initiator methionine of most peptides, except for those with a proline in second position (PubMed : 27484799). Also displays N-epsilon-acetyltransferase activity by mediating acetylation of the side chain of specific lysines on proteins (PubMed : 19744929). Autoacetylates in vivo (PubMed : 19744929). The relevance of N-epsilon-acetyltransferase activity is however unclear : able to acetylate H4 in vitro, but this result has not been confirmed in vivo (PubMed : 19744929). Component of N-alpha-acetyltransferase complexes containing NAA10 and NAA15, which has N-alpha-acetyltransferase activity (PubMed : 16507339, PubMed : 27484799, PubMed : 29754825, PubMed : 32042062). Does not influence the acetyltransferase activity of NAA10 (PubMed : 16507339, PubMed : 27484799). However, it negatively regulates the N-alpha-acetyltransferase activity of the N-terminal acetyltransferase A complex (also called the NatA complex) (PubMed : 32042062). The multiprotein complexes probably constitute the major contributor for N-terminal acetylation at the ribosome exit tunnel, with NAA10 acetylating all amino termini that are devoid of methionine and NAA50 acetylating other peptides (PubMed : 16507339, PubMed : 27484799). Required for sister chromatid cohesion during mitosis by promoting binding of CDCA5/sororin to cohesin : may act by counteracting the function of NAA10 (PubMed : 17502424, PubMed : 27422821).

Sequence similarities

Belongs to the acetyltransferase family. GNAT subfamily.

Subcellular localisation

Nucleus

Product protocols

Target data

N-alpha-acetyltransferase that acetylates the N-terminus of proteins that retain their initiating methionine (PubMed : 19744929, PubMed : 21900231, PubMed : 22311970, PubMed : 27484799). Has a broad substrate specificity : able to acetylate the initiator methionine of most peptides, except for those with a proline in second position (PubMed : 27484799). Also displays N-epsilon-acetyltransferase activity by mediating acetylation of the side chain of specific lysines on proteins (PubMed : 19744929). Autoacetylates in vivo (PubMed : 19744929). The relevance of N-epsilon-acetyltransferase activity is however unclear : able to acetylate H4 in vitro, but this result has not been confirmed in vivo (PubMed : 19744929). Component of N-alpha-acetyltransferase complexes containing NAA10 and NAA15, which has N-alpha-acetyltransferase activity (PubMed : 16507339, PubMed : 27484799, PubMed : 29754825, PubMed : 32042062). Does not influence the acetyltransferase activity of NAA10 (PubMed : 16507339, PubMed : 27484799). However, it negatively regulates the N-alpha-acetyltransferase activity of the N-terminal acetyltransferase A complex (also called the NatA complex) (PubMed : 32042062). The multiprotein complexes probably constitute the major contributor for N-terminal acetylation at the ribosome exit tunnel, with NAA10 acetylating all amino termini that are devoid of methionine and NAA50 acetylating other peptides (PubMed : 16507339, PubMed : 27484799). Required for sister chromatid cohesion during mitosis by promoting binding of CDCA5/sororin to cohesin : may act by counteracting the function of NAA10 (PubMed : 17502424, PubMed : 27422821).
See full target information NAA50

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com