JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152670

Recombinant Human Nav1.6/SCN8A protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Nav1.6/SCN8A protein (GST tag N-Terminus) is a Human Fragment protein, in the 1854 to 1951 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

MED, SCN8A, Sodium channel protein type 8 subunit alpha, Sodium channel protein type VIII subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.6

1 Images
SDS-PAGE - Recombinant Human Nav1.6/SCN8A protein (GST tag N-Terminus) (AB152670)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Nav1.6/SCN8A protein (GST tag N-Terminus) (AB152670)

12.5% SDS-PAGE analysis of ab152670 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

Q9UQD0

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Nav1.6.

Sequence info

[{"sequence":"RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT","proteinLength":"Fragment","predictedMolecularWeight":"36.52 kDa","actualMolecularWeight":null,"aminoAcidEnd":1951,"aminoAcidStart":1854,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9UQD0","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Nav1.6 also known as SCN8A is a voltage-gated sodium channel with a molecular mass of approximately 260 kDa. It is well-known for its significant role in propagating action potentials in neurons. Nav1.6 is highly expressed in the central nervous system specifically in the nodes of Ranvier and axon initial segments of neurons. This channel allows the influx of sodium ions which is critical for the rapid depolarization phase of action potentials facilitating nerve signal transmission.
Biological function summary

Nav1.6 impacts neuronal excitability and firing by controlling sodium ion flow across the nerve cell membrane. It forms an integral part of the channel complex that ensures proper electrical signaling within neurons. It largely contributes to high-frequency firing and sustained repetitive firing of specific neurons which is essential for normal brain function. Alterations in Nav1.6 function can lead to abnormal electrical activity in the nervous system impacting overall neuronal communication.

Pathways

Nav1.6 participates significantly in the action potential propagation pathway. It plays a role alongside other sodium channels such as Nav1.1 and Nav1.2 to maintain the intricate balance of excitatory signals. Nav1.6 is also involved in signaling cascades that affect synaptic transmission and plasticity. In these pathways Nav1.6 interacts indirectly with various ion channels and proteins which collectively modulate neuronal excitability and plasticity important for processes like learning and memory.

Disrupted Nav1.6 function associates with epileptic encephalopathy and ataxia. Mutations in the SCN8A gene that encodes for Nav1.6 can cause abnormal channel activity leading to hyperexcitability of neurons and seizure disorders. Additionally the improper functioning of Nav1.6 links to disorders featuring motor and cognitive impairments. In these contexts Nav1.6 is commonly discussed with proteins like Nav1.2 which also contribute to pathological neuronal excitability highlighting the interconnectedness of ion channel dynamics in neurological diseases.

Specifications

Form

Liquid

General info

Function

Pore-forming subunit of a voltage-gated sodium channel complex assuming opened or closed conformations in response to the voltage difference across membranes and through which sodium ions selectively pass along their electrochemical gradient (PubMed : 24874546, PubMed : 25239001, PubMed : 25725044, PubMed : 26900580, PubMed : 29726066, PubMed : 33245860, PubMed : 36696443, PubMed : 36823201). Contributes to neuronal excitability by regulating action potential threshold and propagation (PubMed : 24874546, PubMed : 25239001, PubMed : 25725044, PubMed : 26900580, PubMed : 29726066, PubMed : 33245860, PubMed : 36696443, PubMed : 36823201).. Isoform 5. More specifically expressed in non-neuronal cells, could play a role in sodium release from intracellular compartments and participate in the control of podosomes formation and macrophages adhesion and movement.

Sequence similarities

Belongs to the sodium channel (TC 1.A.1.10) family. Nav1.6/SCN8A subfamily.

Post-translational modifications

May be ubiquitinated by NEDD4L; which would promote its endocytosis.. Phosphorylation at Ser-1497 by PKC in a highly conserved cytoplasmic loop slows inactivation of the sodium channel and reduces peak sodium currents.

Product protocols

Target data

Pore-forming subunit of a voltage-gated sodium channel complex assuming opened or closed conformations in response to the voltage difference across membranes and through which sodium ions selectively pass along their electrochemical gradient (PubMed : 24874546, PubMed : 25239001, PubMed : 25725044, PubMed : 26900580, PubMed : 29726066, PubMed : 33245860, PubMed : 36696443, PubMed : 36823201). Contributes to neuronal excitability by regulating action potential threshold and propagation (PubMed : 24874546, PubMed : 25239001, PubMed : 25725044, PubMed : 26900580, PubMed : 29726066, PubMed : 33245860, PubMed : 36696443, PubMed : 36823201).. Isoform 5. More specifically expressed in non-neuronal cells, could play a role in sodium release from intracellular compartments and participate in the control of podosomes formation and macrophages adhesion and movement.
See full target information SCN8A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com