JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114304

Recombinant Human Nav1.7 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Nav1.7 protein is a Human Fragment protein, in the 269 to 339 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

NENA, SCN9A, Sodium channel protein type 9 subunit alpha, Neuroendocrine sodium channel, Peripheral sodium channel 1, Sodium channel protein type IX subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.7, hNE-Na, PN1

1 Images
SDS-PAGE - Recombinant Human Nav1.7 protein (AB114304)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Nav1.7 protein (AB114304)

12.5% SDS-PAGE image showing ab114304 Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

Q15858

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY","proteinLength":"Fragment","predictedMolecularWeight":"33.44 kDa","actualMolecularWeight":null,"aminoAcidEnd":339,"aminoAcidStart":269,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q15858","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Nav1.7 also known as SCN9A is a voltage-gated sodium channel. This protein has a mass of approximately 260 kDa. It plays a role in the generation and conduction of action potentials in neurons. Nav1.7 is found mainly in peripheral neurons including dorsal root ganglia and sympathetic ganglia. These neurons are part of the sensory pathways responsible for transmitting pain signals.
Biological function summary

Nav1.7 acts as an essential component in neuronal excitability. It is not part of a larger protein complex but operates as an individual unit within the cell membrane. By allowing sodium ions to enter the neuron Nav1.7 contributes to the depolarization phase of action potentials. This function is critical in the propagation of electrical signals in the nervous system specifically in nociceptive neurons that are involved in pain sensation.

Pathways

Nav1.7 is integral to the nociceptive pain pathway. It works with other sodium channels such as Nav1.8 which also play roles in pain sensation. Nav1.7's activity helps to initiate and maintain action potentials facilitating the transmission of pain signals to the central nervous system. Additionally Nav1.7 is linked to neuropathic pain pathways where its function underpins the continuous firing of neurons even in the absence of external stimuli.

Nav1.7 mutations have a significant association with primary erythromelalgia and congenital indifference to pain. Mutations that cause gain-of-function in Nav1.7 can lead to primary erythromelalgia resulting in extreme pain and redness in the body’s extremities. Conversely loss-of-function mutations can cause congenital indifference to pain where individuals experience little to no pain sensation. Nav1.7 works alongside Nav1.8 in these conditions as both are involved in the modulation of pain signals.

Specifications

Form

Liquid

General info

Function

Pore-forming subunit of Nav1.7, a voltage-gated sodium (Nav) channel that directly mediates the depolarizing phase of action potentials in excitable membranes. Navs, also called VGSCs (voltage-gated sodium channels) or VDSCs (voltage-dependent sodium channels), operate by switching between closed and open conformations depending on the voltage difference across the membrane. In the open conformation they allow Na(+) ions to selectively pass through the pore, along their electrochemical gradient. The influx of Na(+) ions provokes membrane depolarization, initiating the propagation of electrical signals throughout cells and tissues (PubMed : 15385606, PubMed : 16988069, PubMed : 17145499, PubMed : 17167479, PubMed : 19369487, PubMed : 24311784, PubMed : 25240195, PubMed : 26680203, PubMed : 7720699). Nav1.7 plays a crucial role in controlling the excitability and action potential propagation from nociceptor neurons, thereby contributing to the sensory perception of pain (PubMed : 17145499, PubMed : 17167479, PubMed : 19369487, PubMed : 24311784).

Sequence similarities

Belongs to the sodium channel (TC 1.A.1.10) family. Nav1.7/SCN9A subfamily.

Post-translational modifications

Phosphorylation at Ser-1490 by PKC in a highly conserved cytoplasmic loop increases peak sodium currents.. Ubiquitinated by NEDD4L; which may promote its endocytosis.

Product protocols

Target data

Pore-forming subunit of Nav1.7, a voltage-gated sodium (Nav) channel that directly mediates the depolarizing phase of action potentials in excitable membranes. Navs, also called VGSCs (voltage-gated sodium channels) or VDSCs (voltage-dependent sodium channels), operate by switching between closed and open conformations depending on the voltage difference across the membrane. In the open conformation they allow Na(+) ions to selectively pass through the pore, along their electrochemical gradient. The influx of Na(+) ions provokes membrane depolarization, initiating the propagation of electrical signals throughout cells and tissues (PubMed : 15385606, PubMed : 16988069, PubMed : 17145499, PubMed : 17167479, PubMed : 19369487, PubMed : 24311784, PubMed : 25240195, PubMed : 26680203, PubMed : 7720699). Nav1.7 plays a crucial role in controlling the excitability and action potential propagation from nociceptor neurons, thereby contributing to the sensory perception of pain (PubMed : 17145499, PubMed : 17167479, PubMed : 19369487, PubMed : 24311784).
See full target information SCN9A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com