JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB128456

Recombinant Human NCE2/UBE2F protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NCE2/UBE2F protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 185 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

NCE2, UBE2F, NEDD8-conjugating enzyme UBE2F, NEDD8 carrier protein UBE2F, NEDD8 protein ligase UBE2F, NEDD8-conjugating enzyme 2, RING-type E3 NEDD8 transferase UBE2F, Ubiquitin-conjugating enzyme E2 F

1 Images
SDS-PAGE - Recombinant Human NCE2/UBE2F protein (His tag N-Terminus) (AB128456)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NCE2/UBE2F protein (His tag N-Terminus) (AB128456)

15% SDS-PAGE analysis of 3 μg ab128456.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q969M7

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as NCE2

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR","proteinLength":"Full Length","predictedMolecularWeight":"23.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":185,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q969M7","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NCE2/UBE2F also known simply as UBE2F acts as a ubiquitin-conjugating enzyme that is critical in the process of neddylation. The mass of UBE2F is approximately 21 kDa. It plays a mechanical role in transferring the activated NEDD8 protein to target substrates which include members of the Cullin-RING ligase complexes. Expression of UBE2F is observed in multiple human tissues with notable presence in the lungs and liver. Its activity ensures the proper modification of proteins that depend on neddylation for their function.
Biological function summary

UBE2F functions as an important component in cellular processes by participating in the neddylation pathway. It forms a complex with NEDD8-activating E1 enzymes facilitating the transfer of NEDD8 to specific E3 ligases primarily targeting cullins. Through neddylation UBE2F influences the activation of these ligases impacting protein degradation pathways cell cycle regulation and signal transduction. This functional role positions UBE2F as an important player in maintaining cellular homeostasis.

Pathways

UBE2F integrates into the neddylation and ubiquitination pathways. Neddylation specifically modulates ubiquitin-proteasome system where NEDD8 acts as a regulator of Cullin-RING E3 ligase activity. Through these interactions UBE2F contributes to the regulation of protein turnover alongside ubiquitin itself. Connections in these pathways often involve proteins like CUL5 which works synchronously with UBE2F to ensure proper cell cycle progression and stress response in cells.

UBE2F has associations with cancer development such as lung cancer and neurodegenerative conditions like Parkinson's disease. Its role in cancer ties to abnormal neddylation activity where overactive maintenance of cullin function disrupts cell cycle control. In Parkinson’s UBE2F-related dysregulation affects protein homeostasis and neuronal health. Proteins linked to disorders like UbcH12 for cancer highlight UBE2F's involvement in complex cellular mechanisms that contribute to disease pathophysiology.

Specifications

Form

Liquid

Additional notes

ab128456 is purified using conventional chromatography techniques.

General info

Function

Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins (PubMed : 19250909, PubMed : 23201271). Together with the E3 ubiquitin ligase RNF7/RBX2, specifically neddylates cullin-5 (CUL5) (PubMed : 19250909, PubMed : 23201271, PubMed : 23300442). Does not neddylate CUL1, CUL2, CUL3, CUL4A or CUL4B (PubMed : 19250909, PubMed : 23201271). Mediates neddylation of the CUL9-RBX1 complex (PubMed : 38605244).. (Microbial infection) Following infection by HIV-1 virus, participates to HIV-1 Vif protein-mediated ubiquitination and degradation of APOBEC3G by mediating neddylation of cullin-5 (CUL5).

Sequence similarities

Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.

Post-translational modifications

The acetylation of Met-1 increases affinity for DCUN1D3 by about 2 orders of magnitude and is crucial for NEDD8 transfer to cullins.

Product protocols

Target data

Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins (PubMed : 19250909, PubMed : 23201271). Together with the E3 ubiquitin ligase RNF7/RBX2, specifically neddylates cullin-5 (CUL5) (PubMed : 19250909, PubMed : 23201271, PubMed : 23300442). Does not neddylate CUL1, CUL2, CUL3, CUL4A or CUL4B (PubMed : 19250909, PubMed : 23201271). Mediates neddylation of the CUL9-RBX1 complex (PubMed : 38605244).. (Microbial infection) Following infection by HIV-1 virus, participates to HIV-1 Vif protein-mediated ubiquitination and degradation of APOBEC3G by mediating neddylation of cullin-5 (CUL5).
See full target information UBE2F

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com