JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159933

Recombinant Human NCOA4 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NCOA4 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 575 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

ARA70, ELE1, RFG, NCOA4, Nuclear receptor coactivator 4, NCoA-4, Androgen receptor coactivator 70 kDa protein, Androgen receptor-associated protein of 70 kDa, Ferritin cargo receptor NCOA4, Ret-activating protein ELE1, 70 kDa AR-activator, 70 kDa androgen receptor coactivator

1 Images
SDS-PAGE - Recombinant Human NCOA4 protein (GST tag N-Terminus) (AB159933)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NCOA4 protein (GST tag N-Terminus) (AB159933)

ab159933 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q13772

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDENCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIKNSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKYYLIHLYRRNITSPQTIMASLQFVISLPVCSLKLIKRSGYIELLYRCEGMDKS","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":575,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q13772","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The nuclear receptor coactivator 4 (NCOA4) also previously known as androgen receptor-associated protein 70 (ARA70) plays a critical role in cellular activities. It engages with nuclear receptors to enhance transcriptional activities. The molecular weight of NCOA4 is approximately 70 kDa. Scientists have observed its expression in various tissues including prostate and thyroid indicating its diverse functional capacity.
Biological function summary

NCOA4 modulates cellular iron homeostasis which is essential for cell survival and proliferation. It accomplishes this by mediating the autophagic degradation of ferritin a protein that stores iron through ferritinophagy. As part of the ferritinophagy complex NCOA4 works alongside other autophagic machinery to regulate iron bioavailability and mitigate oxidative stress maintaining cellular health and function.

Pathways

NCOA4 significantly influences the iron metabolism pathway an important component in maintaining iron balance within cells. The interaction with proteins such as ferritin highlights its role in facilitating iron release and utilization. Furthermore NCOA4 intersects with the autophagy pathway where it coordinates with autophagic proteins like LC3 to ensure proper iron recycling emphasizing its integration in cellular nutrient management.

Dysregulation of NCOA4 has links to neurodegenerative diseases like Parkinson’s disease where iron dysmetabolism plays a part in neuronal damage. Aberrant NCOA4 activity also relates to certain cancers as iron levels influence tumor growth. In these contexts NCOA4's interaction with proteins like p62 an important autophagy adaptor becomes critical highlighting its influence in disease progression and potential as a therapeutic target.

Specifications

Form

Liquid

General info

Function

Cargo receptor for the autophagic turnover of the iron-binding ferritin complex, playing a central role in iron homeostasis (PubMed : 25327288, PubMed : 26436293). Acts as an adapter for delivery of ferritin to lysosomes and autophagic degradation of ferritin, a process named ferritinophagy (PubMed : 25327288, PubMed : 26436293). Targets the iron-binding ferritin complex to autolysosomes following starvation or iron depletion (PubMed : 25327288). Ensures efficient erythropoiesis, possibly by regulating hemin-induced erythroid differentiation (PubMed : 26436293). In some studies, has been shown to enhance the androgen receptor AR transcriptional activity as well as acting as ligand-independent coactivator of the peroxisome proliferator-activated receptor (PPAR) gamma (PubMed : 10347167, PubMed : 8643607). Another study shows only weak behavior as a coactivator for the androgen receptor and no alteration of the ligand responsiveness of the AR (PubMed : 10517667). Binds to DNA replication origins, binding is not restricted to sites of active transcription and may likely be independent from the nuclear receptor transcriptional coactivator function (PubMed : 24910095). May inhibit activation of DNA replication origins, possibly by obstructing DNA unwinding via interaction with the MCM2-7 complex (PubMed : 24910095).

Post-translational modifications

NCOA4 levels may be regulated via HERC2-mediated ubiquitination leading to proteosomal degradation; HERC2 association is dependent on NCOA4 iron occupancy.

Product protocols

Target data

Cargo receptor for the autophagic turnover of the iron-binding ferritin complex, playing a central role in iron homeostasis (PubMed : 25327288, PubMed : 26436293). Acts as an adapter for delivery of ferritin to lysosomes and autophagic degradation of ferritin, a process named ferritinophagy (PubMed : 25327288, PubMed : 26436293). Targets the iron-binding ferritin complex to autolysosomes following starvation or iron depletion (PubMed : 25327288). Ensures efficient erythropoiesis, possibly by regulating hemin-induced erythroid differentiation (PubMed : 26436293). In some studies, has been shown to enhance the androgen receptor AR transcriptional activity as well as acting as ligand-independent coactivator of the peroxisome proliferator-activated receptor (PPAR) gamma (PubMed : 10347167, PubMed : 8643607). Another study shows only weak behavior as a coactivator for the androgen receptor and no alteration of the ligand responsiveness of the AR (PubMed : 10517667). Binds to DNA replication origins, binding is not restricted to sites of active transcription and may likely be independent from the nuclear receptor transcriptional coactivator function (PubMed : 24910095). May inhibit activation of DNA replication origins, possibly by obstructing DNA unwinding via interaction with the MCM2-7 complex (PubMed : 24910095).
See full target information NCOA4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com