JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB174406

Recombinant Human Ndfip1 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Ndfip1 protein (His tag N-Terminus) is a Human Fragment protein, in the 1 to 116 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

N4WBP5, PSEC0192, PSEC0223, NDFIP1, NEDD4 family-interacting protein 1, Breast cancer-associated protein SGA-1M, NEDD4 WW domain-binding protein 5, Putative MAPK-activating protein PM13, Putative NF-kappa-B-activating protein 164, Putative NFKB and MAPK-activating protein

1 Images
SDS-PAGE - Recombinant Human Ndfip1 protein (His tag N-Terminus) (AB174406)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Ndfip1 protein (His tag N-Terminus) (AB174406)

15% SDS-PAGE analysis of ab174406 at 3μg. Note : Molecular size on SDS-PAGE will appear higher than calculated.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9BT67

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDG","proteinLength":"Fragment","predictedMolecularWeight":"14.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":116,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9BT67","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Ndfip1 also known as Nedd4 family interacting protein 1 serves important roles in cellular processes by acting as an adaptor protein that facilitates interaction between Nedd4 family E3 ubiquitin ligases and their substrates. Ndfip1 has a mass of approximately 30 kDa and contains PY motifs which are essential for binding with WW domains of Nedd4 ligases. This protein is ubiquitously expressed but shows higher expression levels in neuronal tissues and immune cells. As Ndfip1 is vital for the regulation of protein degradation it regulates multiple signaling pathways through substrate ubiquitination.
Biological function summary

Ndfip1 regulates intracellular protein levels and maintains cellular homeostasis. By interacting with Nedd4 ligases Ndfip1 assists in the ubiquitination of target proteins marking them for degradation by the proteasome. Ndfip1 does not form a complex itself but rather acts as a facilitator for the formation of ubiquitin ligase complexes. Through this mechanism Ndfip1 affects processes such as endocytosis transcriptional regulation and signal transduction.

Pathways

Ndfip1 plays a significant role in the ubiquitin-proteasome pathway where it aids the degradation of specific proteins to regulate cell signaling. It directly connects with Nedd4 proteins within this pathway affecting substrates that include growth factor receptors and signaling kinases. Another pathway involving Ndfip1 is the immune response pathway where it modulates cytokine receptor turnover impacting immune cell behavior and inflammation.

Ndfip1 is linked to neurodegenerative diseases and immune disorders. Its dysfunction has been studied in the context of Parkinson's disease where misregulation of ubiquitination processes can contribute to neuronal damage. Additionally Ndfip1 associations with immune response pathways suggest its involvement in inflammatory disorders through regulation of cytokine signaling. In these conditions altered interaction with proteins like Nedd4 and cytokine receptors underlies its contribution to disease mechanisms.

Specifications

Form

Liquid

General info

Function

Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, and consequently modulates the stability of their targets. As a result, controls many cellular processes. Prevents chronic T-helper cell-mediated inflammation by activating ITCH and thus controlling JUNB degradation (By similarity). Promotes pancreatic beta cell death through degradation of JUNB and inhibition of the unfolded protein response, leading to reduction of insulin secretion (PubMed : 26319551). Restricts the production of pro-inflammatory cytokines in effector Th17 T-cells by promoting ITCH-mediated ubiquitination and degradation of RORC (By similarity). Together with NDFIP2, limits the cytokine signaling and expansion of effector Th2 T-cells by promoting degradation of JAK1, probably by ITCH- and NEDD4L-mediated ubiquitination (By similarity). Regulates peripheral T-cell tolerance to self and foreign antigens, forcing the exit of naive CD4+ T-cells from the cell cycle before they become effector T-cells (By similarity). Negatively regulates RLR-mediated antiviral response by promoting SMURF1-mediated ubiquitination and subsequent degradation of MAVS (PubMed : 23087404). Negatively regulates KCNH2 potassium channel activity by decreasing its cell-surface expression and interfering with channel maturation through recruitment of NEDD4L to the Golgi apparatus where it mediates KCNH2 degradation (PubMed : 26363003). In cortical neurons, mediates the ubiquitination of the divalent metal transporter SLC11A2/DMT1 by NEDD4L, leading to its down-regulation and protection of the cells from cobalt and iron toxicity (PubMed : 19706893). Important for normal development of dendrites and dendritic spines in cortex (By similarity). Enhances the ubiquitination of BRAT1 mediated by : NEDD4, NEDD4L and ITCH and is required for the nuclear localization of ubiquitinated BRAT1 (PubMed : 25631046). Enhances the ITCH-mediated ubiquitination of MAP3K7 by recruiting E2 ubiquitin-conjugating enzyme UBE2L3 to ITCH (By similarity). Modulates EGFR signaling through multiple pathways. In particular, may regulate the ratio of AKT1-to-MAPK8 signaling in response to EGF, acting on AKT1 probably through PTEN destabilization and on MAPK8 through ITCH-dependent MAP2K4 inactivation. As a result, may control cell growth rate (PubMed : 20534535). Inhibits cell proliferation by promoting PTEN nuclear localization and changing its signaling specificity (PubMed : 25801959).

Post-translational modifications

Ubiquitinated by NEDD4 and ITCH; mono-, di- and polyubiquitinated forms are detected. Ubiquitination regulates its degradation.. Undergoes transient tyrosine phosphorylation following EGF stimulation, most probably by catalyzed by SRC. Phosphorylation SRC is enhanced in the presence of NDFIP2 which may act as a scaffold to recruit SRC to NDFIP1.

Subcellular localisation

Endosome membrane

Product protocols

Target data

Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, and consequently modulates the stability of their targets. As a result, controls many cellular processes. Prevents chronic T-helper cell-mediated inflammation by activating ITCH and thus controlling JUNB degradation (By similarity). Promotes pancreatic beta cell death through degradation of JUNB and inhibition of the unfolded protein response, leading to reduction of insulin secretion (PubMed : 26319551). Restricts the production of pro-inflammatory cytokines in effector Th17 T-cells by promoting ITCH-mediated ubiquitination and degradation of RORC (By similarity). Together with NDFIP2, limits the cytokine signaling and expansion of effector Th2 T-cells by promoting degradation of JAK1, probably by ITCH- and NEDD4L-mediated ubiquitination (By similarity). Regulates peripheral T-cell tolerance to self and foreign antigens, forcing the exit of naive CD4+ T-cells from the cell cycle before they become effector T-cells (By similarity). Negatively regulates RLR-mediated antiviral response by promoting SMURF1-mediated ubiquitination and subsequent degradation of MAVS (PubMed : 23087404). Negatively regulates KCNH2 potassium channel activity by decreasing its cell-surface expression and interfering with channel maturation through recruitment of NEDD4L to the Golgi apparatus where it mediates KCNH2 degradation (PubMed : 26363003). In cortical neurons, mediates the ubiquitination of the divalent metal transporter SLC11A2/DMT1 by NEDD4L, leading to its down-regulation and protection of the cells from cobalt and iron toxicity (PubMed : 19706893). Important for normal development of dendrites and dendritic spines in cortex (By similarity). Enhances the ubiquitination of BRAT1 mediated by : NEDD4, NEDD4L and ITCH and is required for the nuclear localization of ubiquitinated BRAT1 (PubMed : 25631046). Enhances the ITCH-mediated ubiquitination of MAP3K7 by recruiting E2 ubiquitin-conjugating enzyme UBE2L3 to ITCH (By similarity). Modulates EGFR signaling through multiple pathways. In particular, may regulate the ratio of AKT1-to-MAPK8 signaling in response to EGF, acting on AKT1 probably through PTEN destabilization and on MAPK8 through ITCH-dependent MAP2K4 inactivation. As a result, may control cell growth rate (PubMed : 20534535). Inhibits cell proliferation by promoting PTEN nuclear localization and changing its signaling specificity (PubMed : 25801959).
See full target information NDFIP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com