JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB181901

Recombinant Human NDUFA4 protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NDUFA4 protein (denatured) (His tag N-Terminus) is a Human Full Length protein, in the 1 to 81 aa range, expressed in Escherichia coli, with >80%, suitable for SDS-PAGE.

View Alternative Names

Cytochrome c oxidase subunit NDUFA4, Complex I-MLRQ, NADH-ubiquinone oxidoreductase MLRQ subunit, CI-MLRQ, NDUFA4

1 Images
SDS-PAGE - Recombinant Human NDUFA4 protein (denatured) (His tag N-Terminus) (AB181901)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human NDUFA4 protein (denatured) (His tag N-Terminus) (AB181901)

15% SDS-PAGE analysis of 3ug ab181901 stained with Coomassie Blue.

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O00483

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF","proteinLength":"Full Length","predictedMolecularWeight":"9 kDa","actualMolecularWeight":null,"aminoAcidEnd":81,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O00483","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NDUFA4 also known as NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4 is a small protein with a molecular mass of around 9 kDa. It plays a role as part of the mitochondrial respiratory chain where it contributes to the electron transport process. NDUFA4 is expressed in various tissues but has higher levels of expression in tissues with elevated metabolic demand like the heart liver and muscle. Its location in the inner mitochondrial membrane allows it to participate directly in respiration activity by aiding electron transfer from NADH to ubiquinone.
Biological function summary

NDUFA4 functions as part of the larger protein complex known as Complex I or NADH:ubiquinone oxidoreductase. Complex I is a critical component of the mitochondrial electron transport chain. It supports ATP synthesis by creating a proton gradient across the inner mitochondrial membrane. NDUFA4 participates in this energy conversion process and cooperates with additional protein subunits in Complex I to maintain cellular energy metabolism. This makes it essential for maintaining efficient aerobic respiration.

Pathways

NDUFA4 has a significant role within the oxidative phosphorylation pathway a central metabolic pathway in cellular energy production. Within this pathway it associates with other proteins such as NDUFB8 and NDUFS1 in Complex I which work together for effective electron transport. NDUFA4 also intersects with the broader pathways of metabolic regulation lending support to the processes that produce ATP as a cellular energy currency.

Mutations or dysregulation of NDUFA4 have been connected to mitochondrial diseases such as mitochondrial myopathy. These conditions arise due to impaired energy production in cells. Additionally alterations in NDUFA4 levels or activity have implications in neurodegenerative disorders like Parkinson's disease. In such diseases proteins like NDUFS4 another Complex I subunit also become affected highlighting potential protein-protein interactions critical for maintaining mitochondrial health.

Specifications

Form

Liquid

General info

Function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules unsing 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix (PubMed : 22902835). NDUFA4 is required for complex IV maintenance (PubMed : 22902835).

Sequence similarities

Belongs to the complex IV NDUFA4 subunit family.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules unsing 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix (PubMed : 22902835). NDUFA4 is required for complex IV maintenance (PubMed : 22902835).
See full target information Cytochrome c oxidase subunit NDUFA4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com