JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271630

Recombinant Human NEK7 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NEK7 protein (His tag) is a Human Full Length protein, in the 2 to 302 aa range, expressed in HEK 293 cells, with >90%.

View Alternative Names

Serine/threonine-protein kinase Nek7, Never in mitosis A-related kinase 7, NimA-related protein kinase 7, NEK7

1 Images
SDS-PAGE - Recombinant Human NEK7 protein (His tag) (AB271630)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human NEK7 protein (His tag) (AB271630)

SDS-PAGE analysis of ab271630.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

His tag N-Terminus

Biologically active

No

Accession

Q8TDX7

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Preservative: 0.95% Imidazole Constituents: 10% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.02% Potassium chloride, 0.01% TCEP HCl

storage-buffer

Sequence info

[{"sequence":"DEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS","proteinLength":"Full Length","predictedMolecularWeight":"37 kDa","actualMolecularWeight":null,"aminoAcidEnd":302,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q8TDX7","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The NIMA-related kinase 7 (NEK7) is a member of the NEK family of serine/threonine kinases and plays an important role in cell division. With a molecular mass of approximately 34 kDa the NEK7 protein is involved in mitosis by regulating microtubule organization. It is primarily expressed in various tissues including human and marmoset thyroid tissues. It remains mainly inactive until mitotic entry where its activity becomes essential for proper spindle formation and completion of mitosis.
Biological function summary

Cell cycle progression heavily depends on NEK7's function. NEK7 interacts with NEDD1 in the microtubule-organizing center contributing to centrosome maturation and separation. This interaction makes NEK7 vital in the recruitment of γ-tubulin ring complex which is necessary for nucleating microtubules. NEK7 operates independently from the other NEK family members but shares involvement in centrosome-related activities.

Pathways

NEK7 is influential in the regulation of the mitotic spindle assembly pathway and the interleukin-1 (IL-1) signaling pathway. It is closely related to proteins like NEK6 and NEK9 which also play roles in mitotic progression and cytokinesis. NEK7's involvement in these pathways indicates its integrative function in ensuring normal cell division and response to inflammatory signals.

NEK7 has implications in cancer and inflammatory ailments. NEK7 overexpression or mutation is often linked to tumorigenesis particularly in lung and brain cancers. Additionally NEK7 contributes to the activation of the NLRP3 inflammasome connecting it to inflammatory conditions like rheumatoid arthritis. The interplay with NLRP3 highlights the significance of NEK7 in inflammation-related diseases.

Specifications

Form

Liquid

General info

Function

Protein kinase which plays an important role in mitotic cell cycle progression (PubMed : 17101132, PubMed : 19941817, PubMed : 31409757). Required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis (PubMed : 17586473, PubMed : 19414596, PubMed : 19941817, PubMed : 26522158, PubMed : 31409757). Phosphorylates EML4 at 'Ser-146', promoting its dissociation from microtubules during mitosis which is required for efficient chromosome congression (PubMed : 31409757). Phosphorylates RPS6KB1 (By similarity). Acts as an essential activator of the NLRP3 inflammasome assembly independently of its kinase activity (PubMed : 26642356, PubMed : 36442502). Acts by unlocking NLRP3 following NLRP3 tranlocation into the microtubule organizing center (MTOC), relieving NLRP3 autoinhibition and promoting formation of the NLRP3 : PYCARD complex, and activation of CASP1 (PubMed : 26642356, PubMed : 31189953, PubMed : 36442502). Serves as a cellular switch that enforces mutual exclusivity of the inflammasome response and cell division : interaction with NEK9 prevents interaction with NLRP3 and activation of the inflammasome during mitosis (PubMed : 26642356, PubMed : 31189953).

Sequence similarities

Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.

Post-translational modifications

Phosphorylation at Ser-195 required for its activation.

Subcellular localisation

Nucleus

Product protocols

Target data

Protein kinase which plays an important role in mitotic cell cycle progression (PubMed : 17101132, PubMed : 19941817, PubMed : 31409757). Required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis (PubMed : 17586473, PubMed : 19414596, PubMed : 19941817, PubMed : 26522158, PubMed : 31409757). Phosphorylates EML4 at 'Ser-146', promoting its dissociation from microtubules during mitosis which is required for efficient chromosome congression (PubMed : 31409757). Phosphorylates RPS6KB1 (By similarity). Acts as an essential activator of the NLRP3 inflammasome assembly independently of its kinase activity (PubMed : 26642356, PubMed : 36442502). Acts by unlocking NLRP3 following NLRP3 tranlocation into the microtubule organizing center (MTOC), relieving NLRP3 autoinhibition and promoting formation of the NLRP3 : PYCARD complex, and activation of CASP1 (PubMed : 26642356, PubMed : 31189953, PubMed : 36442502). Serves as a cellular switch that enforces mutual exclusivity of the inflammasome response and cell division : interaction with NEK9 prevents interaction with NLRP3 and activation of the inflammasome during mitosis (PubMed : 26642356, PubMed : 31189953).
See full target information NEK7

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com