JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB161609

Recombinant Human Nesprin1/Syne-1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Nesprin1/Syne-1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 1561 to 1670 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

C6orf98, KIAA0796, KIAA1262, KIAA1756, MYNE1, SYNE1, Nesprin-1, Enaptin, KASH domain-containing protein 1, Myocyte nuclear envelope protein 1, Nuclear envelope spectrin repeat protein 1, Synaptic nuclear envelope protein 1, KASH1, Myne-1, Syne-1

1 Images
SDS-PAGE - Recombinant Human Nesprin1/Syne-1 protein (GST tag N-Terminus) (AB161609)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Nesprin1/Syne-1 protein (GST tag N-Terminus) (AB161609)

ab161609 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q8NF91

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Nesprin 1.

Sequence info

[{"sequence":"LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTW","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":1670,"aminoAcidStart":1561,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q8NF91","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Nesprin1 also known as Syne-1 is a large spectrin repeat protein with a mass of approximately 1002 kDa. It is part of the plakin family of proteins and plays an important role in linking the nuclear envelope to the actin cytoskeleton. Nesprin1 is widely expressed in skeletal and cardiac muscle tissues where it helps maintain nuclear positioning and structural integrity. This protein has several isoforms resulting from alternative splicing which allows it to perform diverse functions in different cellular contexts.
Biological function summary

Nesprin1 acts as an important component of the LINC (Linker of Nucleoskeleton and Cytoskeleton) complex. The LINC complex connects the nuclear envelope to the cytoskeleton facilitating mechanical signal transduction and cellular communication. Nesprin1's interactions with other elements of the cytoskeleton and nuclear envelope help regulate nuclear anchoring and positioning essential for cellular dynamics and function. In muscle cells Nesprin1 stabilizes the nucleus and synchronizes cellular responses to mechanical stress.

Pathways

Nesprin1 participates in nuclear-cytoskeletal coupling pathways that are vital for cellular biomechanics. It associates with proteins such as SUN1 and SUN2 within the LINC complex to mediate structural continuity between the nucleus and the cytoskeleton. Furthermore it plays a role in the mechanotransduction pathway linking external mechanical signals to gene expression changes. This connection is significant for maintaining cellular homeostasis and adaptability in response to mechanical stress.

Nesprin1 mutations are associated with muscular dystrophies particularly Emery-Dreifuss muscular dystrophy (EDMD). This condition involves muscle weakness and cardiac issues highlighting the importance of Nesprin1 in muscle tissue integrity. Additionally Nesprin1 has been linked to cardiomyopathies where its interaction with proteins like emerin and lamin A/C is important for maintaining cardiac muscle health. Alterations in these interactions can lead to disrupted nuclear architecture and contribute to the pathogenesis of these disorders.

Specifications

Form

Liquid

General info

Function

Multi-isomeric modular protein which forms a linking network between organelles and the actin cytoskeleton to maintain the subcellular spatial organization. As a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. May be involved in nucleus-centrosome attachment and nuclear migration in neural progenitors implicating LINC complex association with SUN1/2 and probably association with cytoplasmic dynein-dynactin motor complexes; SYNE1 and SYNE2 may act redundantly. Required for centrosome migration to the apical cell surface during early ciliogenesis. May be involved in nuclear remodeling during sperm head formation in spermatogenesis; a probable SUN3 : SYNE1/KASH1 LINC complex may tether spermatid nuclei to posterior cytoskeletal structures such as the manchette.

Sequence similarities

Belongs to the nesprin family.

Post-translational modifications

The disulfid bond with SUN1 or SUN2 is required for stability of the respective LINC complex under tensile forces.

Product protocols

Target data

Multi-isomeric modular protein which forms a linking network between organelles and the actin cytoskeleton to maintain the subcellular spatial organization. As a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. May be involved in nucleus-centrosome attachment and nuclear migration in neural progenitors implicating LINC complex association with SUN1/2 and probably association with cytoplasmic dynein-dynactin motor complexes; SYNE1 and SYNE2 may act redundantly. Required for centrosome migration to the apical cell surface during early ciliogenesis. May be involved in nuclear remodeling during sperm head formation in spermatogenesis; a probable SUN3 : SYNE1/KASH1 LINC complex may tether spermatid nuclei to posterior cytoskeletal structures such as the manchette.
See full target information SYNE1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com