JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB160463

Recombinant Human Neurexin 1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human Neurexin 1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 31 to 130 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

KIAA0578, NRXN1, Neurexin-1, Neurexin I-alpha, Neurexin-1-alpha

1 Images
SDS-PAGE - Recombinant Human Neurexin 1 protein (GST tag N-Terminus) (AB160463)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Neurexin 1 protein (GST tag N-Terminus) (AB160463)

ab160463 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q9ULB1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFI","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":130,"aminoAcidStart":31,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9ULB1","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Neurexin 1 is a synaptic adhesion molecule involved in the formation and maintenance of synapses. Commonly referred to as NRXN1 this protein exists as part of the larger neurexin family which includes neurexin 1 alpha. Neurexin 1 has a molecular weight of approximately 190 kDa and shows expression in neurons of the central nervous system contributing to communication between neurons by stabilizing the synaptic junctions. It acts as a bridge between presynaptic and postsynaptic cells facilitating efficient signal transmission.
Biological function summary

Neurexin 1 participates in the assembly of trans-synaptic signaling complexes. It forms complexes with neuroligins which are postsynaptic cell adhesion proteins impacting synaptic specificity and connectivity. Through its interactions Neurexin 1 helps organize and regulate synaptic transmission influencing the efficiency and plasticity of synaptic connections. These processes are important for proper brain function impacting learning and memory retention.

Pathways

Neurexin 1 plays significant parts in neurotransmitter release mechanisms. It is involved in synaptic vesicle exocytosis pathway where it interacts with the presynaptic active zone components to influence neurotransmitter release. Additionally Neurexin 1 is linked to the glutamatergic synapse pathway where it interacts with neuroligins to modulate excitatory synaptic strength. These interactions ensure the balance of excitatory and inhibitory signals within neural networks.

Neurexin 1 has connections to autism spectrum disorders and schizophrenia. Alterations in Neurexin 1 gene have been associated with synaptic dysfunctions observed in these conditions. Studies suggest that mutations within the NRXN1 gene can disrupt normal synaptic activity contributing to the pathophysiology of these neurodevelopmental and psychiatric disorders. Neurexin 1 also interacts with neuroligins and SHANK3 both implicated in autism and schizophrenia establishing a further link between synaptic stabilization and disease manifestations.

Specifications

Form

Liquid

General info

Function

Cell surface protein involved in cell-cell-interactions, exocytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca(2+)-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca(2+)-triggered exocytosis of secretory granules in pituitary gland. They may affect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latrotoxin from spider venom.

Sequence similarities

Belongs to the neurexin family.

Post-translational modifications

O-glycosylated; contains heparan sulfate. Heparan sulfate attachment is required for synapse development by mediating interactions with neuroligins and LRRTM2.

Product protocols

Target data

Cell surface protein involved in cell-cell-interactions, exocytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca(2+)-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca(2+)-triggered exocytosis of secretory granules in pituitary gland. They may affect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latrotoxin from spider venom.
See full target information NRXN1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Stroke 46:2607-15 PubMed26219651

2015

Role of Neurexin-1β and Neuroligin-1 in Cognitive Dysfunction After Subarachnoid Hemorrhage in Rats.

Applications

Unspecified application

Species

Unspecified reactive species

Haitao Shen,Zhouqing Chen,Yang Wang,Anju Gao,Haiying Li,Yonghua Cui,Li Zhang,Xiang Xu,Zhong Wang,Gang Chen
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com