JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB167850

Recombinant Human Neuromedin B protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Neuromedin B protein (denatured) (His tag N-Terminus) is a Human Full Length protein, in the 25 to 121 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

Neuromedin-B, NMB

1 Images
SDS-PAGE - Recombinant Human Neuromedin B protein (denatured) (His tag N-Terminus) (AB167850)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Neuromedin B protein (denatured) (His tag N-Terminus) (AB167850)

15% SDS-PAGE analysis of 3µg ab167850.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P08949

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK","proteinLength":"Full Length","predictedMolecularWeight":"13.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":121,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P08949","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Neuromedin B also known as NMB is a peptide that functions as a neurotransmitter or hormone. It is involved in a variety of physiological processes. With a molecular mass of approximately 1.6 kDa neuromedin B is part of the bombesin-like peptide family. This peptide is expressed in several areas of the body including the central nervous system and gastrointestinal tract. In these regions it interacts with neuromedin B receptors (NMBRs) which belong to the G-protein-coupled receptor family.
Biological function summary

Neuromedin B influences several physiological functions such as regulation of smooth muscle contraction thermoregulation and the release of anterior pituitary hormones. It plays a role in the modulation of circadian rhythms and feeding behavior. Neuromedin B is not typically part of a complex but its biological activity is strongly dependent on its interaction with its specific receptor NMBR. The peptide-receptor interaction activates downstream signaling pathways that mediate its effects.

Pathways

Several important biological pathways involve neuromedin B. One of these pathways is the G-protein signaling pathway which influences neurotransmission and hormone release. Neuromedin B affects this process through its receptor-mediated activation of G-proteins. Another important pathway is the MAPK/ERK pathway where neuromedin B through NMBR participates in cell growth and survival processes. Neuromedin B is related to proteins such as gastrin-releasing peptide (GRP) that also belongs to the bombesin-like family sharing similarities in receptor interaction and signaling functions.

Neuromedin B has associations with certain types of cancers and metabolic disorders. For example abnormal expression or dysfunction in the signaling of neuromedin B has been implicated in lung cancer. It can influence tumor growth and proliferation due to its effects on cellular pathways. Neuromedin B is also involved in metabolic disorders impacting energy balance and body weight regulation. Through these diseases neuromedin B connects with other proteins such as GRP which similarly has a role in cancer and metabolic regulation.

Specifications

Form

Liquid

General info

Function

Stimulates smooth muscle contraction (By similarity). Induces sighing by acting directly on the pre-Botzinger complex, a cluster of several thousand neurons in the ventrolateral medulla responsible for inspiration during respiratory activity (By similarity). Contributes to the induction of sneezing following exposure to chemical irritants or allergens which causes release of NMB by nasal sensory neurons and activation of NMBR-expressing neurons in the sneeze-evoking region of the brainstem (By similarity). These in turn activate neurons of the caudal ventral respiratory group, giving rise to the sneezing response (By similarity). Contributes to induction of acute itch, possibly through activation of the NMBR receptor on dorsal root ganglion neurons (By similarity). Increases expression of NMBR and steroidogenic mediators STAR, CYP11A1 and HSD3B1 in Leydig cells, induces secretion of testosterone by Leydig cells and also promotes Leydig cell proliferation (By similarity). Plays a role in the innate immune response to influenza A virus infection by enhancing interferon alpha expression and reducing expression of IL6 (PubMed : 31601264). Plays a role in CSF1-induced proliferation of osteoclast precursors by contributing to the positive regulation of the expression of the CSF1 receptor CSF1R (By similarity).

Sequence similarities

Belongs to the bombesin/neuromedin-B/ranatensin family.

Product protocols

Target data

Stimulates smooth muscle contraction (By similarity). Induces sighing by acting directly on the pre-Botzinger complex, a cluster of several thousand neurons in the ventrolateral medulla responsible for inspiration during respiratory activity (By similarity). Contributes to the induction of sneezing following exposure to chemical irritants or allergens which causes release of NMB by nasal sensory neurons and activation of NMBR-expressing neurons in the sneeze-evoking region of the brainstem (By similarity). These in turn activate neurons of the caudal ventral respiratory group, giving rise to the sneezing response (By similarity). Contributes to induction of acute itch, possibly through activation of the NMBR receptor on dorsal root ganglion neurons (By similarity). Increases expression of NMBR and steroidogenic mediators STAR, CYP11A1 and HSD3B1 in Leydig cells, induces secretion of testosterone by Leydig cells and also promotes Leydig cell proliferation (By similarity). Plays a role in the innate immune response to influenza A virus infection by enhancing interferon alpha expression and reducing expression of IL6 (PubMed : 31601264). Plays a role in CSF1-induced proliferation of osteoclast precursors by contributing to the positive regulation of the expression of the CSF1 receptor CSF1R (By similarity).
See full target information Neuromedin-B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com