JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB131674

Recombinant Human NKG2C protein (denatured)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NKG2C protein (denatured) is a Human Fragment protein, in the 94 to 231 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

CD159c, NKG2C, KLRC2, NKG2-C type II integral membrane protein, CD159 antigen-like family member C, NK cell receptor C, NKG2-C-activating NK receptor

1 Images
SDS-PAGE - Recombinant Human NKG2C protein (denatured) (AB131674)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NKG2C protein (denatured) (AB131674)

15% SDS-PAGE analysis of 3 µg ab131674.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P26717

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMIPFLEQNNFSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL","proteinLength":"Fragment","predictedMolecularWeight":"18.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":231,"aminoAcidStart":94,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P26717","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NKG2C also known as CD159c is a receptor protein that plays an important role in immune responses. This protein has an approximate mass of 30 kDa and is usually found on the surface of natural killer (NK) cells. NKG2C belongs to the family of C-type lectin receptors and forms heterodimers with the signaling adaptor protein DAP12. These heterodimers are expressed on NK cells and certain T cell subsets enabling the cells to recognize and respond to infected or transformed cells.
Biological function summary

NKG2C serves as an activating receptor for NK cells and certain T cells enhancing their cytotoxic functions. It participates in the recognition of cells expressing human cytomegalovirus (HCMV) proteins allowing the immune system to target and eliminate these infected cells efficiently. This receptor acts in a complex with DAP12 through which it transmits activation signals inside the immune cells. The engagement of NKG2C with its ligands initiates the production and release of cytokines and lytic granules promoting the destruction of target cells.

Pathways

NKG2C functions within the immune signaling pathways by interacting with other receptors and molecules on NK cells. The receptor is involved in pathways that activate NK cell-mediated cytotoxicity and cytokine production. NKG2C interacts with other natural killer receptors such as NKG2A and NKG2E contributing to the regulation of immune responses. The balance of signals from different receptors including NKG2C and NKG2A defines the activation and inhibition states of NK cells impacting both innate and adaptive immunity.

NKG2C expression has significance in viral infections and autoimmune diseases. In cases of viral infections like HCMV increased expression of NKG2C enhances the immune response against the virus by recognizing the virus-infected cells. In autoimmune disorders changes in NKG2C expression or function can alter immune regulation which may exacerbate disease conditions. NKG2C and its relationship with DAP12 as well as other immune receptors make it a valuable target for therapeutic interventions in these conditions.

Specifications

Form

Liquid

General info

Function

Immune activating receptor involved in self-nonself discrimination. In complex with KLRD1 on cytotoxic lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules, likely playing a role in the generation and effector functions of adaptive natural killer (NK) cells and in maternal-fetal tolerance during pregnancy (PubMed : 30134159, PubMed : 37264229, PubMed : 9754572). Regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, and in particular may play a role in adaptive NK cell response to viral infection (PubMed : 20952657, PubMed : 21825173). Upon HLA-E-peptide binding, transmits intracellular signals via the adapter protein TYROBP/DAP12, triggering the phosphorylation of proximal signaling molecules and cell activation (PubMed : 15940674, PubMed : 9655483).

Product protocols

Target data

Immune activating receptor involved in self-nonself discrimination. In complex with KLRD1 on cytotoxic lymphocyte subsets, recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules, likely playing a role in the generation and effector functions of adaptive natural killer (NK) cells and in maternal-fetal tolerance during pregnancy (PubMed : 30134159, PubMed : 37264229, PubMed : 9754572). Regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, and in particular may play a role in adaptive NK cell response to viral infection (PubMed : 20952657, PubMed : 21825173). Upon HLA-E-peptide binding, transmits intracellular signals via the adapter protein TYROBP/DAP12, triggering the phosphorylation of proximal signaling molecules and cell activation (PubMed : 15940674, PubMed : 9655483).
See full target information KLRC2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com