JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB227395

Recombinant human NKG2D protein (Fc tag C-Terminus + His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human NKG2D protein (Fc tag C-Terminus + His tag C-Terminus) is a Human Fragment protein, in the 73 to 216 aa range, expressed in Baculovirus infected insect cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

CD314, D12S2489E, NKG2D, KLRK1, NKG2-D type II integral membrane protein, Killer cell lectin-like receptor subfamily K member 1, NK cell receptor D, NKG2-D-activating NK receptor

2 Images
Functional Studies - Recombinant human NKG2D protein (Fc tag C-Terminus + His tag C-Terminus) (AB227395)
  • FuncS

Supplier Data

Functional Studies - Recombinant human NKG2D protein (Fc tag C-Terminus + His tag C-Terminus) (AB227395)

Human ULBP-6/RAET1L is coated at 10 μg/ml (100 μl/well) can bind Human NKG2D. The ED50 range ≤ 1.5 μg/ml.

SDS-PAGE - Recombinant human NKG2D protein (Fc tag C-Terminus + His tag C-Terminus) (AB227395)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human NKG2D protein (Fc tag C-Terminus + His tag C-Terminus) (AB227395)

15% SDS-PAGE analysis of 3 μg ab227395.

MW : 40-57 kDa (SDS-PAGE under reducing conditions).

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Baculovirus infected insect cells

Tags

Fc tag C-Terminus His tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA with Human ULBP-6/RAET1L. The ED50 range ≤ 1.5 ug/ml.

Accession

P26718

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ADPIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTVVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"43.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":216,"aminoAcidStart":73,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"P26718","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NKG2D also known as natural killer group 2 member D is a type-2 transmembrane receptor with a mass of approximately 42 kDa. Expressed primarily on natural killer (NK) cells CD8+ T cells subsets of CD4+ T cells and some macrophages it recognizes stress-induced ligands presented on target cells. This protein plays an important role in the immune system's recognition and elimination of infected or transformed cells by binding to its ligands which include MHC class I chain-related proteins MICA/B and UL16-binding proteins.
Biological function summary

NKG2D acts as an activating receptor on the cell surface that initiates immune responses leading to cytotoxicity against target cells. It functions as part of a complex involving the adaptor protein DAP10 which transduces activating signals to promote cellular immune responses. This interaction amplifies the activation of immune cells and contributes to the host's defense against tumors and virally infected cells.

Pathways

NKG2D plays a significant role in immune surveillance and signaling pathways. It actively involves in the natural killer (NK) cell-mediated cytotoxicity pathway and the adaptive immune response pathway. The interaction with proteins such as DAP10 is critical for its signaling function contributing to its interaction within these pathways. The signaling through NKG2D directly affects the activation states and responses of immune cells which are vital in immune defense.

NKG2D is implicated in cancer and autoimmune diseases. In cancer overexpression of its ligands on tumor cells makes them susceptible to NKG2D-mediated cell lysis. On the other hand aberrant expression of NKG2D ligands in autoimmune disorders can lead to inappropriate immune activation. The interaction with MICA/B proteins is significant in these conditions emphasizing its importance in both immune surveillance and potential disease pathogenesis.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.

Product protocols

Target data

Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.
See full target information KLRK1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com