JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB211310

Recombinant human NM23A protein (Active) (Tag Free)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human NM23A protein (Active) (Tag Free) is a Human Full Length protein, in the 1 to 152 aa range, expressed in Escherichia coli, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec.

View Alternative Names

NDPKA, NM23, NME1, Nucleoside diphosphate kinase A, NDK A, NDP kinase A, Granzyme A-activated DNase, Metastasis inhibition factor nm23, NM23-H1, Tumor metastatic process-associated protein, GAAD

1 Images
SDS-PAGE - Recombinant human NM23A protein (Active) (Tag Free) (AB211310)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human NM23A protein (Active) (Tag Free) (AB211310)

15% SDS-PAGE analysis of ab211310 (3 μg).

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

Mass Spec, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific activity is > 1,200 units/mg, and is defined as the amount of enzyme that convert 1.0 umole each of ATP and TDP to ADP and TTP per minute at pH 7.5 at 25°C in a couple system with PK/LDH.

Accession

P15531

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 10% Glycerol (glycerin, glycerine), 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE","proteinLength":"Full Length","predictedMolecularWeight":"17 kDa","actualMolecularWeight":null,"aminoAcidEnd":152,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P15531","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NM23A also known as NME1 (non-metastatic cells 1 protein) is a nucleoside diphosphate kinase A. NM23A weighs approximately 17 kDa. This protein is expressed in a variety of tissues with high levels in liver brain and endocrine tissues. By exchanging phosphate groups NM23A is involved in energy transfer in cells. It stabilizes proteins by forming hexameric complexes which are pivotal for its function.
Biological function summary

The NME1 protein plays a significant role in cell proliferation and differentiation. It acts as a marker for the metastatic potential of some tumors where lower expression links to increased metastatic abilities in tumor cells. This protein sometimes works as part of a larger multiprotein complex which influences its functions in cellular processes. It is known for modulating microtubule assembly which affects cell structure and mechanics.

Pathways

NM23A is an important player in signal transduction and DNA repair pathways. It is essential in the regulation of the Ras-MAPK pathway which controls cell growth and differentiation. NM23A interacts with key regulatory proteins such as c-Myc and APC to uphold cellular activities. The protein's influence in these pathways indicates its role in sustaining normal cellular functions and responses.

NM23A relates closely to cancer particularly in metastatic processes and tumor progression. Lower levels of NM23A are associated with the progression of neuroblastoma and breast cancer. In breast cancer NM23A links to the tumor suppressor gene p53 affecting its regulatory functions. Research continues into how NM23A can serve as a useful biomarker for prognosis and therapy in cancer treatment.

Specifications

Form

Liquid

Additional notes

ab211310 was purified using conventional chromatography techniques.

General info

Function

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination. During GZMA-mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair.

Sequence similarities

Belongs to the NDK family.

Subcellular localisation

Nucleus

Product protocols

Target data

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination. During GZMA-mediated cell death, works in concert with TREX1. NME1 nicks one strand of DNA and TREX1 removes bases from the free 3' end to enhance DNA damage and prevent DNA end reannealing and rapid repair.
See full target information NME1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com