JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112298

Recombinant Human NMDAR2B protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NMDAR2B protein is a Human Fragment protein, in the 127 to 236 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

NMDAR2B, GRIN2B, GluN2B, Glutamate [NMDA] receptor subunit epsilon-2, N-methyl D-aspartate receptor subtype 2B, N-methyl-D-aspartate receptor subunit 3, NR2B, NR3, hNR3

1 Images
SDS-PAGE - Recombinant Human NMDAR2B protein (AB112298)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NMDAR2B protein (AB112298)

ab112298 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

Q13224

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

useful for Antibody Production and Protein Array

Sequence info

[{"sequence":"HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE","proteinLength":"Fragment","predictedMolecularWeight":"37.73 kDa","actualMolecularWeight":null,"aminoAcidEnd":236,"aminoAcidStart":127,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q13224","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NMDAR2B also known as NR2B or GluN2B functions as a subunit of the NMDA receptor complex. It plays a role in synaptic transmission and plasticity in the central nervous system. The target weighs approximately 166 kDa. It is highly expressed in the cerebral cortex hippocampus and striatum. NMDAR2B interacts with other subunits in the NMDA receptor which assemble to form a functional ion channel that allows for calcium ion influx when activated by glutamate and glycine.
Biological function summary

The NMDAR2B subunit contributes to the regulation of synaptic strength and is essential for processes involved in learning and memory. As part of the NMDA receptor complex it mediates excitatory neurotransmission and is involved in synaptic plasticity processes such as long-term potentiation (LTP). These functions are significant for cognitive function and neural development. The receptor's role in signal transduction is aided by the unique properties conferred by the NMDAR2B subunit such as its high affinity for glycine and slower deactivation kinetics.

Pathways

NMDAR2B is involved in the glutamatergic signaling pathway which is important for neural communication. It also participates in the calcium signaling pathway affecting cellular responses to external stimuli. The protein interacts with CaMKII and PSD-95 which are proteins that influence synaptic strength and architecture through these pathways. Its involvement links it to a variety of signaling events important for brain function.

Alterations in NMDAR2B have been associated with neurodegenerative conditions such as Alzheimer's disease and neurodevelopmental disorders like schizophrenia. The protein's malfunction can lead to abnormal synaptic connectivity and excitotoxicity. It is linked to other proteins associated with these diseases such as beta-amyloid in Alzheimer's and dopamine receptor dysregulation in schizophrenia indicating its role in disease progression and symptom manifestation.

Specifications

Form

Liquid

General info

Function

Component of N-methyl-D-aspartate (NMDA) receptors (NMDARs) that function as heterotetrameric, ligand-gated cation channels with high calcium permeability and voltage-dependent block by Mg(2+) (PubMed : 24272827, PubMed : 24863970, PubMed : 26875626, PubMed : 26919761, PubMed : 27839871, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). Participates in synaptic plasticity for learning and memory formation by contributing to the long-term depression (LTD) of hippocampus membrane currents (By similarity). Channel activation requires binding of the neurotransmitter L-glutamate to the GluN2 subunit, glycine or D-serine binding to the GluN1 subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+) (PubMed : 24272827, PubMed : 24863970, PubMed : 26875626, PubMed : 26919761, PubMed : 27839871, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). NMDARs mediate simultaneously the potasium efflux and the influx of calcium and sodium (By similarity). Each GluN2 subunit confers differential attributes to channel properties, including activation, deactivation and desensitization kinetics, pH sensitivity, Ca2(+) permeability, and binding to allosteric modulators (PubMed : 26875626, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). In concert with DAPK1 at extrasynaptic sites, acts as a central mediator for stroke damage. Its phosphorylation at Ser-1303 by DAPK1 enhances synaptic NMDA receptor channel activity inducing injurious Ca2+ influx through them, resulting in an irreversible neuronal death (By similarity).

Sequence similarities

Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR2B/GRIN2B subfamily.

Post-translational modifications

Phosphorylated on tyrosine residues (By similarity). Phosphorylation at Ser-1303 by DAPK1 enhances synaptic NMDA receptor channel activity (By similarity).

Subcellular localisation

Late endosome

Product protocols

Target data

Component of N-methyl-D-aspartate (NMDA) receptors (NMDARs) that function as heterotetrameric, ligand-gated cation channels with high calcium permeability and voltage-dependent block by Mg(2+) (PubMed : 24272827, PubMed : 24863970, PubMed : 26875626, PubMed : 26919761, PubMed : 27839871, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). Participates in synaptic plasticity for learning and memory formation by contributing to the long-term depression (LTD) of hippocampus membrane currents (By similarity). Channel activation requires binding of the neurotransmitter L-glutamate to the GluN2 subunit, glycine or D-serine binding to the GluN1 subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+) (PubMed : 24272827, PubMed : 24863970, PubMed : 26875626, PubMed : 26919761, PubMed : 27839871, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). NMDARs mediate simultaneously the potasium efflux and the influx of calcium and sodium (By similarity). Each GluN2 subunit confers differential attributes to channel properties, including activation, deactivation and desensitization kinetics, pH sensitivity, Ca2(+) permeability, and binding to allosteric modulators (PubMed : 26875626, PubMed : 28095420, PubMed : 28126851, PubMed : 38538865, PubMed : 8768735). In concert with DAPK1 at extrasynaptic sites, acts as a central mediator for stroke damage. Its phosphorylation at Ser-1303 by DAPK1 enhances synaptic NMDA receptor channel activity inducing injurious Ca2+ influx through them, resulting in an irreversible neuronal death (By similarity).
See full target information GRIN2B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com