JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB211313

Recombinant human NME2 protein (Tag Free)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human NME2 protein (Tag Free) is a Human Fragment protein, in the 1 to 152 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, FuncS, Mass Spec.

View Alternative Names

NM23B, NME2, Nucleoside diphosphate kinase B, NDK B, NDP kinase B, C-myc purine-binding transcription factor PUF, Histidine protein kinase NDKB, nm23-H2

1 Images
SDS-PAGE - Recombinant human NME2 protein (Tag Free) (AB211313)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human NME2 protein (Tag Free) (AB211313)

15% SDS-PAGE analysis of ab211313 (3 μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

FuncS, SDS-PAGE, Mass Spec

applications

Biologically active

Yes

Biological activity

Specific activity is >1,800 units/mg, and is defined as the amount of enzyme that convert 1.0 umole each of ATP and TDP to ADP and TTP per minute at pH 7.5 at 25°C in a couple system with PK/LDH.

Accession

P22392

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE","proteinLength":"Fragment","predictedMolecularWeight":"17.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":152,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P22392","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NME2 also known as NM23-H2 is a nucleoside diphosphate kinase that is involved in the synthesis of nucleoside triphosphates. With a mass of approximately 17 kDa it plays a role in the energetic metabolism of cells. NME2 is widely expressed in various tissues including the liver heart and brain. Its expression levels indicate its importance in maintaining regular cellular functions.
Biological function summary

NME2 participates in the regulation of transcription and cellular differentiation. It acts within the context of protein complexes which influence DNA-binding activities required for transcriptional control. NME2 also has roles in the regulation of cell proliferation differentiation and signaling. These activities demonstrate the protein's significance in maintaining normal physiological processes.

Pathways

NME2 is active in the MAPK/ERK signaling pathway significant in cell growth and differentiation. It interacts with other proteins like ERK2 to modulate downstream signaling cascades. This protein also features in the GTP nucleotide biosynthesis pathway where it cooperates with other kinases for nucleotide metabolism highlighting its important role in cell cycle regulation.

Mutations or altered expression of NME2 link with various cancers including breast and colon cancer. This connection emphasizes its potential role as a biomarker or therapeutic target. The protein also associates with other oncogenes like NME1 together contributing to the metastatic potential of cancer cells. NME2's involvement in chronic conditions like cancer confirms its importance in pathological states where it may influence disease progression or serve as a clinical marker.

Specifications

Form

Liquid

Additional notes

ab211313 was purified using conventional chromatography techniques.

General info

Function

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC (PubMed : 15249197). Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically (PubMed : 19435876, PubMed : 8392752). Binds to both single-stranded guanine- and cytosine-rich strands within the nuclease hypersensitive element (NHE) III(1) region of the MYC gene promoter. Does not bind to duplex NHE III(1) (PubMed : 19435876). Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds both folded and unfolded G4 with similar low nanomolar affinities. Stabilizes folded G4s regardless of whether they are prefolded or not (PubMed : 25679041). Exhibits histidine protein kinase activity (PubMed : 20946858).

Sequence similarities

Belongs to the NDK family.

Subcellular localisation

Nucleus

Product protocols

Target data

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC (PubMed : 15249197). Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically (PubMed : 19435876, PubMed : 8392752). Binds to both single-stranded guanine- and cytosine-rich strands within the nuclease hypersensitive element (NHE) III(1) region of the MYC gene promoter. Does not bind to duplex NHE III(1) (PubMed : 19435876). Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds both folded and unfolded G4 with similar low nanomolar affinities. Stabilizes folded G4s regardless of whether they are prefolded or not (PubMed : 25679041). Exhibits histidine protein kinase activity (PubMed : 20946858).
See full target information NME2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com