JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB211318

Recombinant human NME3 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human NME3 protein (His tag N-Terminus) is a Human Fragment protein, in the 22 to 169 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, FuncS, Mass Spec.

View Alternative Names

Nucleoside diphosphate kinase 3, NDK 3, NDP kinase 3, DR-nm23, Nucleoside diphosphate kinase C, nm23-H3, NDPKC, NME3

1 Images
SDS-PAGE - Recombinant human NME3 protein (His tag N-Terminus) (AB211318)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human NME3 protein (His tag N-Terminus) (AB211318)

15% SDS-PAGE analysis of ab211318 (3μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific activity is > 150 units/mg, and is defined as the amount of enzyme that convert 1.0 umole each of ATP and TDP to ADP and TTP per minute at pH 7.5 at 25°C in a couple system with PK/LDH.

Accession

Q13232

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 50% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE","proteinLength":"Fragment","predictedMolecularWeight":"19.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":169,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q13232","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NME3 also known as non-metastatic cells protein 3 is a part of the nucleoside diphosphate kinase (NDPK) family. This protein has a molecular mass of approximately 17.3 kDa. Scientists have reported its expression in various tissues with particular abundance in lungs and brain. NME3 interacts with nucleotides participating in phosphate transfer reactions by converting nucleoside diphosphates into nucleoside triphosphates.
Biological function summary

Non-metastatic cells protein 3 plays a role in maintaining cellular nucleotide homeostasis. NME3 is a member of a larger NDPK complex working closely with other NDPK family members like NME1 and NME2. This complex contributes to DNA replication and repair processes. It also influences cell proliferation and differentiation by regulating the levels of GTP and other nucleotides important for these biological processes.

Pathways

There is significant involvement of non-metastatic cells protein 3 in cellular energy metabolism and signal transduction pathways. NME3 participates in the Ras signaling pathway where it interacts with Ras proteins regulating their activation state. Additionally NME3 functions within the Wnt signaling pathway contributing to cell cycle regulation and development.

Non-metastatic cells protein 3 associates with cancer where altered NME3 expression correlates with tumor progression and metastasis. Studies indicate that changes in NME3 can disrupt interactions with proteins like NME1 influencing cancer cell motility and invasion. NME3 also connects with neurodegenerative disorders with dysregulation possibly affecting cellular processes that protect against neuronal cell death.

Specifications

Form

Liquid

Additional notes

ab211318 was purified using conventional chromatography.

General info

Function

Catalyzes the phosphorylation of ribonucleosides and deoxyribonucleoside diphosphates, other than ATP, into the corresponding triphosphates with ATP as the major phosphate donor (PubMed : 11277919, PubMed : 30587587). The ATP gamma phosphate is transferred to the nucleoside diphosphate beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis (PubMed : 11277919, PubMed : 30587587). Inhibits granulocyte differentiation (PubMed : 7638209). May be required for ciliary function during renal development (By similarity).. Independently of its kinase activity, facilitates mitochondrial tethering prior to membrane fusion through its direct membrane-binding and hexamerization (PubMed : 30587587, PubMed : 37584589). Implicated in repair of both single- and double-stranded breaks in DNA through its association with the ribonucleotide reductase complex (RNR complex) via its interaction with the histone acetyltransferase KAT5, this interaction enables recruitment of NME3 at DNA damage sites where it plays a role in the repair of DNA, independently of its kinase activity (PubMed : 37584589).

Sequence similarities

Belongs to the NDK family.

Product protocols

Target data

Catalyzes the phosphorylation of ribonucleosides and deoxyribonucleoside diphosphates, other than ATP, into the corresponding triphosphates with ATP as the major phosphate donor (PubMed : 11277919, PubMed : 30587587). The ATP gamma phosphate is transferred to the nucleoside diphosphate beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis (PubMed : 11277919, PubMed : 30587587). Inhibits granulocyte differentiation (PubMed : 7638209). May be required for ciliary function during renal development (By similarity).. Independently of its kinase activity, facilitates mitochondrial tethering prior to membrane fusion through its direct membrane-binding and hexamerization (PubMed : 30587587, PubMed : 37584589). Implicated in repair of both single- and double-stranded breaks in DNA through its association with the ribonucleotide reductase complex (RNR complex) via its interaction with the histone acetyltransferase KAT5, this interaction enables recruitment of NME3 at DNA damage sites where it plays a role in the repair of DNA, independently of its kinase activity (PubMed : 37584589).
See full target information Nucleoside diphosphate kinase 3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com