JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB107133

Recombinant Human NME4 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NME4 protein is a Human Full Length protein, in the 33 to 187 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

NM23D, NME4, NDK, Nucleoside diphosphate kinase D, nm23-H4, NDPKD

1 Images
SDS-PAGE - Recombinant Human NME4 protein (AB107133)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NME4 protein (AB107133)

15% SDS-PAGE showing ab107133 (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

O00746

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA","proteinLength":"Full Length","predictedMolecularWeight":"19.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":187,"aminoAcidStart":33,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O00746","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NME4 also known as nucleoside diphosphate kinase D is a mitochondrial protein with a mass of approximately 17 kDa. It is found in the inner mitochondrial membrane and is part of the NDP (nucleoside diphosphate) kinase family. This protein plays a role in transferring gamma-phosphates from nucleoside triphosphates to nucleoside diphosphates facilitating essential cellular energy transactions. NME4's catalytic activity helps maintain the balance and availability of nucleotides within the mitochondria.
Biological function summary

Nucleoside diphosphate kinase activity of NME4 contributes to energy homeostasis in cells. It assists in the generation of nucleoside triphosphates necessary for mitochondrial function and integrity. NME4 operates as part of multimeric complexes within the mitochondria ensuring efficient energy metabolism. Its role extends to contributing to cellular signaling pathways by providing the necessary energy substrates for a variety of cellular responses and activities.

Pathways

Researchers have found that NME4 is involved in the regulation of the mitochondrial apoptotic pathway. It interacts with other proteins involved in apoptosis such as Bcl-2 family members by influencing the mitochondrial outer membrane permeability. Additionally NME4 participates in pathways related to oxidative phosphorylation working alongside other proteins like ATP synthase to optimize energy production and utilization. These interactions underpin its versatility in sustaining cellular energy requirements and influencing cell survival.

Dysfunction in NME4 activity has been linked to mitochondrial diseases and cancer. In particular alterations in NME4 have implications in mitochondrial myopathy where energy production becomes compromised. Similarly cancer studies have shown changes in NME4 expression affect tumor growth and survival often in conjunction with proteins involved in metabolic regulation like p53. Understanding NME4's interactions and modifications can provide insights into its role in these diseases and potential therapeutic targets.

Specifications

Form

Liquid

Additional notes

ab107133 is purified using conventional chromatography techniques.

General info

Function

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis (PubMed : 10799505). Binds to anionic phospholipids, predominantly to cardiolipin; the binding inhibits its phosphotransfer activity (PubMed : 18635542, PubMed : 23150663). Acts as a mitochondria-specific NDK; its association with cardiolipin-containing mitochondrial inner membrane is coupled to respiration suggesting that ADP locally regenerated in the mitochondrion innermembrane space by its activity is directly taken up via ANT ADP/ATP translocase into the matrix space to stimulate respiratory ATP regeneration (PubMed : 18635542). Proposed to increase GTP-loading on dynamin-related GTPase OPA1 in mitochondria (PubMed : 24970086). In vitro can induce liposome cross-linking suggesting that it can cross-link inner and outer membranes to form contact sites, and promotes intermembrane migration of anionic phosphoplipids. Promotes the redistribution of cardiolipin between the mitochondrial inner membrane and outer membrane which is implicated in pro-apoptotic signaling (PubMed : 17028143, PubMed : 18635542, PubMed : 23150663).

Sequence similarities

Belongs to the NDK family.

Subcellular localisation

Mitochondrion intermembrane space

Product protocols

Target data

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis (PubMed : 10799505). Binds to anionic phospholipids, predominantly to cardiolipin; the binding inhibits its phosphotransfer activity (PubMed : 18635542, PubMed : 23150663). Acts as a mitochondria-specific NDK; its association with cardiolipin-containing mitochondrial inner membrane is coupled to respiration suggesting that ADP locally regenerated in the mitochondrion innermembrane space by its activity is directly taken up via ANT ADP/ATP translocase into the matrix space to stimulate respiratory ATP regeneration (PubMed : 18635542). Proposed to increase GTP-loading on dynamin-related GTPase OPA1 in mitochondria (PubMed : 24970086). In vitro can induce liposome cross-linking suggesting that it can cross-link inner and outer membranes to form contact sites, and promotes intermembrane migration of anionic phosphoplipids. Promotes the redistribution of cardiolipin between the mitochondrial inner membrane and outer membrane which is implicated in pro-apoptotic signaling (PubMed : 17028143, PubMed : 18635542, PubMed : 23150663).
See full target information NME4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com