JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB268816

Recombinant human NNMT protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human NNMT protein (Active) is a Human Full Length protein, in the 1 to 264 aa range, expressed in Barley, with >95%, suitable for SDS-PAGE, FuncS.

View Alternative Names

Nicotinamide N-methyltransferase, NNMT

2 Images
Functional Studies - Recombinant human NNMT protein (Active) (AB268816)
  • FuncS

Supplier Data

Functional Studies - Recombinant human NNMT protein (Active) (AB268816)

The specific activity of ab268816 was 220 nmol/min/mg in a methyltransferase assay using nicotinamide as substrate.

SDS-PAGE - Recombinant human NNMT protein (Active) (AB268816)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human NNMT protein (Active) (AB268816)

SDS-PAGE analysis of ab268816.

Key facts

Purity

>95% SDS-PAGE

Expression system

Barley

Tags

GST tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

The specific activity of ab268816 was 220 nmol/min/mg in a methyltransferase assay using nicotinamide as substrate.

Accession

P40261

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":264,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Barley","accessionNumber":"P40261","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The NNMT protein also known as Nicotinamide N-methyltransferase acts by catalyzing the methylation of nicotinamide using S-adenosylmethionine as a methyl donor. This enzyme has a mass of around 29 kDa and is expressed in various tissues including liver adipose tissue and certain cancer cells. The NNMT gene provides instructions for creating the protein that plays significant roles in metabolic processes and cellular homeostasis.
Biological function summary

NNMT impacts cell energy balance and gene expression regulation by influencing the levels of nicotinamide and methionine metabolites. This enzyme does not typically form part of a complex acting more so as an individual regulator of methylation reactions affecting cellular metabolism. Researchers find interest in NNMT for its role in modulating cellular growth and proliferation forming a link to both normal cellular functions and pathological conditions like cancer.

Pathways

NNMT has a significance in NAD+ metabolism and methionine salvage pathways. These pathways are essential in maintaining redox homeostasis and proper methylation status in cells. NNMT through its enzymatic activity interacts with SAM (S-adenosyl methionine) closely relating its function to methylation processes that involve other proteins such as SIRTs (Sirtuins) and NAMPT (Nicotinamide phosphoribosyltransferase) within these metabolic pathways.

NNMT shows relevance in cancer and obesity-related complications. The protein's upregulation in cancer types like breast and colorectal cancers links it to tumor development and progression. In obesity NNMT's involvement in adipose tissue might contribute to metabolic dysregulation. The enzyme also interconnects with proteins like insulin receptors and adiponectin highlighting its potential role in metabolic diseases and making it an interesting target for therapeutic interventions.

Specifications

Form

Liquid

General info

Function

Catalyzes the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway (PubMed : 21823666, PubMed : 23455543, PubMed : 8182091). Plays a central role in regulating cellular methylation potential, by consuming S-adenosyl-L-methionine and limiting its availability for other methyltransferases. Actively mediates genome-wide epigenetic and transcriptional changes through hypomethylation of repressive chromatin marks, such as H3K27me3 (PubMed : 23455543, PubMed : 26571212, PubMed : 31043742). In a developmental context, contributes to low levels of the repressive histone marks that characterize pluripotent embryonic stem cell pre-implantation state (PubMed : 26571212). Acts as a metabolic regulator primarily on white adipose tissue energy expenditure as well as hepatic gluconeogenesis and cholesterol biosynthesis. In white adipocytes, regulates polyamine flux by consuming S-adenosyl-L-methionine which provides for propylamine group in polyamine biosynthesis, whereas by consuming nicotinamide controls NAD(+) levels through the salvage pathway (By similarity). Via its product N1-methylnicotinamide regulates protein acetylation in hepatocytes, by repressing the ubiquitination and increasing the stability of SIRT1 deacetylase (By similarity). Can also N-methylate other pyridines structurally related to nicotinamide and play a role in xenobiotic detoxification (PubMed : 30044909).

Sequence similarities

Belongs to the class I-like SAM-binding methyltransferase superfamily. NNMT/PNMT/TEMT family.

Post-translational modifications

Deiminated by PADI1 and PADI2.

Product protocols

Target data

Catalyzes the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway (PubMed : 21823666, PubMed : 23455543, PubMed : 8182091). Plays a central role in regulating cellular methylation potential, by consuming S-adenosyl-L-methionine and limiting its availability for other methyltransferases. Actively mediates genome-wide epigenetic and transcriptional changes through hypomethylation of repressive chromatin marks, such as H3K27me3 (PubMed : 23455543, PubMed : 26571212, PubMed : 31043742). In a developmental context, contributes to low levels of the repressive histone marks that characterize pluripotent embryonic stem cell pre-implantation state (PubMed : 26571212). Acts as a metabolic regulator primarily on white adipose tissue energy expenditure as well as hepatic gluconeogenesis and cholesterol biosynthesis. In white adipocytes, regulates polyamine flux by consuming S-adenosyl-L-methionine which provides for propylamine group in polyamine biosynthesis, whereas by consuming nicotinamide controls NAD(+) levels through the salvage pathway (By similarity). Via its product N1-methylnicotinamide regulates protein acetylation in hepatocytes, by repressing the ubiquitination and increasing the stability of SIRT1 deacetylase (By similarity). Can also N-methylate other pyridines structurally related to nicotinamide and play a role in xenobiotic detoxification (PubMed : 30044909).
See full target information Nicotinamide N-methyltransferase

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com