JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB185379

Recombinant Human Nogo protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Nogo protein is a Human Fragment protein, in the 1 to 185 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

KIAA0886, NOGO, My043, SP1507, RTN4, Reticulon-4, Foocen, Neurite outgrowth inhibitor, Neuroendocrine-specific protein, Neuroendocrine-specific protein C homolog, RTN-x, Reticulon-5, Nogo protein, NSP

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE, HPLC

applications

Biologically active

No

Accession

Q9NQC3

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS.

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRGSSGSV","proteinLength":"Fragment","predictedMolecularWeight":"45.59 kDa","actualMolecularWeight":null,"aminoAcidEnd":185,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9NQC3","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Nogo protein also known as RTN4 or Nogo-A is a member of the reticulon family with an approximate mass of 200 kDa. It is known for its inhibitory role in axonal regeneration acting as a potent neurite outgrowth inhibitor. The Nogo protein is widely expressed in the central nervous system especially in oligodendrocytes and the endoplasmic reticulum of neurons. It is an important target in neurobiology due to its involvement in regulating axonal growth.
Biological function summary

Nogo protein plays a critical role in the central nervous system by maintaining the stability of neuronal circuits and preventing excessive or aberrant plasticity. It achieves this through its association with membrane-bound complexes. The Nogo-A variant in particular interacts with the Nogo receptor (NgR1) complex to mediate its effects on axon outgrowth inhibition. This interaction is important for maintaining neural structural integrity under normal physiological conditions.

Pathways

The Nogo protein is integrated into neurite outgrowth-inhibitory pathways influencing neural connectivity. It participates mainly in the RhoA-ROCK signaling pathway a pathway known for its role in modulating the cytoskeleton and neuronal morphology. Through this pathway Nogo interacts with several proteins including the p75 neurotrophin receptor (p75^NTR) mediating downstream effects on cell shape and motility. The regulation of this pathway is significant for understanding axonal regeneration and growth inhibition.

The Nogo protein is relevant in conditions such as spinal cord injury and multiple sclerosis. In spinal cord injuries upregulated Nogo-A expression contributes to the inhibition of axonal regeneration and functional recovery. Similarly in multiple sclerosis Nogo protein's interaction with the myelin-associated inhibitors may exacerbate damage or delay in repair linked with impaired oligodendrocyte function. This connection highlights the potential therapeutic importance of targeting Nogo interactions to promote neurological recovery and repair.

Specifications

Form

Lyophilized

Additional notes

Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

General info

Function

Required to induce the formation and stabilization of endoplasmic reticulum (ER) tubules (PubMed : 24262037, PubMed : 25612671, PubMed : 27619977). They regulate membrane morphogenesis in the ER by promoting tubular ER production (PubMed : 24262037, PubMed : 25612671, PubMed : 27619977, PubMed : 27786289). They influence nuclear envelope expansion, nuclear pore complex formation and proper localization of inner nuclear membrane proteins (PubMed : 26906412). However each isoform have specific functions mainly depending on their tissue expression specificities (Probable).. Isoform A. Developmental neurite growth regulatory factor with a role as a negative regulator of axon-axon adhesion and growth, and as a facilitator of neurite branching. Regulates neurite fasciculation, branching and extension in the developing nervous system. Involved in down-regulation of growth, stabilization of wiring and restriction of plasticity in the adult CNS (PubMed : 10667797, PubMed : 11201742). Regulates the radial migration of cortical neurons via an RTN4R-LINGO1 containing receptor complex (By similarity). Acts as a negative regulator of central nervous system angiogenesis. Inhibits spreading, migration and sprouting of primary brain microvascular endothelial cells (MVECs). Also induces the retraction of MVECs lamellipodia and filopodia in a ROCK pathway-dependent manner (By similarity).. Isoform B. Mainly function in endothelial cells and vascular smooth muscle cells, is also involved in immune system regulation (Probable). Modulator of vascular remodeling, promotes the migration of endothelial cells but inhibits the migration of vascular smooth muscle cells. Regulates endothelial sphingolipid biosynthesis with direct effects on vascular function and blood pressure. Inhibits serine palmitoyltransferase, SPTLC1, the rate-limiting enzyme of the novo sphingolipid biosynthetic pathway, thereby controlling production of endothelial sphingosine-1-phosphate (S1P). Required to promote macrophage homing and functions such as cytokine/chemokine gene expression involved in angiogenesis, arteriogenesis and tissue repair. Mediates ICAM1 induced transendothelial migration of leukocytes such as monocytes and neutrophils and acute inflammation. Necessary for immune responses triggered by nucleic acid sensing TLRs, such as TLR9, is required for proper TLR9 location to endolysosomes. Also involved in immune response to LPS. Plays a role in liver regeneration through the modulation of hepatocytes proliferation (By similarity). Reduces the anti-apoptotic activity of Bcl-xl and Bcl-2. This is likely consecutive to their change in subcellular location, from the mitochondria to the endoplasmic reticulum, after binding and sequestration (PubMed : 11126360). With isoform C, inhibits BACE1 activity and amyloid precursor protein processing (PubMed : 16965550).. Isoform C. Regulates cardiomyocyte apoptosis upon hypoxic conditions (By similarity). With isoform B, inhibits BACE1 activity and amyloid precursor protein processing (PubMed : 16965550).

Product protocols

Target data

Required to induce the formation and stabilization of endoplasmic reticulum (ER) tubules (PubMed : 24262037, PubMed : 25612671, PubMed : 27619977). They regulate membrane morphogenesis in the ER by promoting tubular ER production (PubMed : 24262037, PubMed : 25612671, PubMed : 27619977, PubMed : 27786289). They influence nuclear envelope expansion, nuclear pore complex formation and proper localization of inner nuclear membrane proteins (PubMed : 26906412). However each isoform have specific functions mainly depending on their tissue expression specificities (Probable).. Isoform A. Developmental neurite growth regulatory factor with a role as a negative regulator of axon-axon adhesion and growth, and as a facilitator of neurite branching. Regulates neurite fasciculation, branching and extension in the developing nervous system. Involved in down-regulation of growth, stabilization of wiring and restriction of plasticity in the adult CNS (PubMed : 10667797, PubMed : 11201742). Regulates the radial migration of cortical neurons via an RTN4R-LINGO1 containing receptor complex (By similarity). Acts as a negative regulator of central nervous system angiogenesis. Inhibits spreading, migration and sprouting of primary brain microvascular endothelial cells (MVECs). Also induces the retraction of MVECs lamellipodia and filopodia in a ROCK pathway-dependent manner (By similarity).. Isoform B. Mainly function in endothelial cells and vascular smooth muscle cells, is also involved in immune system regulation (Probable). Modulator of vascular remodeling, promotes the migration of endothelial cells but inhibits the migration of vascular smooth muscle cells. Regulates endothelial sphingolipid biosynthesis with direct effects on vascular function and blood pressure. Inhibits serine palmitoyltransferase, SPTLC1, the rate-limiting enzyme of the novo sphingolipid biosynthetic pathway, thereby controlling production of endothelial sphingosine-1-phosphate (S1P). Required to promote macrophage homing and functions such as cytokine/chemokine gene expression involved in angiogenesis, arteriogenesis and tissue repair. Mediates ICAM1 induced transendothelial migration of leukocytes such as monocytes and neutrophils and acute inflammation. Necessary for immune responses triggered by nucleic acid sensing TLRs, such as TLR9, is required for proper TLR9 location to endolysosomes. Also involved in immune response to LPS. Plays a role in liver regeneration through the modulation of hepatocytes proliferation (By similarity). Reduces the anti-apoptotic activity of Bcl-xl and Bcl-2. This is likely consecutive to their change in subcellular location, from the mitochondria to the endoplasmic reticulum, after binding and sequestration (PubMed : 11126360). With isoform C, inhibits BACE1 activity and amyloid precursor protein processing (PubMed : 16965550).. Isoform C. Regulates cardiomyocyte apoptosis upon hypoxic conditions (By similarity). With isoform B, inhibits BACE1 activity and amyloid precursor protein processing (PubMed : 16965550).
See full target information RTN4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com