JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114178

Recombinant Human Notch1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Notch1 protein is a Human Fragment protein, in the 23 to 132 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

TAN1, NOTCH1, Neurogenic locus notch homolog protein 1, Notch 1, hN1, Translocation-associated notch protein TAN-1

1 Images
SDS-PAGE - Recombinant Human Notch1 protein (AB114178)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Notch1 protein (AB114178)

ab114178 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

P46531

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein)</p>" } } }

Sequence info

[{"sequence":"RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPG","proteinLength":"Fragment","predictedMolecularWeight":"37.73 kDa","actualMolecularWeight":null,"aminoAcidEnd":132,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P46531","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Notch1 also known as Notch-1 is a transmembrane receptor involved in cell fate decisions. It belongs to the Notch protein family and has a molecular weight of around 270 kDa. Notch1 is expressed widely particularly in tissues such as blood cells and neuronal tissue. The receptor consists of extracellular EGF-like repeats a transmembrane domain and an intracellular domain that translocates to the nucleus upon activation. Notch1 plays a critical role in intercellular communication through ligand engagement which then triggers a series of proteolytic cleavages that release the Notch intracellular domain (NICD) for nuclear translocation.
Biological function summary

Notch1 is essential in various cellular processes including differentiation proliferation and apoptosis. It functions as part of a complex signaling pathway that regulates these processes. Notch1 interacts with other elements like Jagged and Delta/Serrate/LAG-2 (DSL) family ligands to control gene expression patterns that determine cell lineage outcomes. This interaction affects the development of many systems such as the immune and nervous systems. Consequently Notch1 significantly influences the formation of organs and the maintenance of stem cell populations.

Pathways

Notch1 plays a significant role in both the Notch signaling and the Wnt signaling pathways. In the Notch signaling pathway Notch1 upon ligand binding partners with CSL (CBF1/RBP-Jκ in mammals) and Mastermind-like proteins for transcriptional regulation. This pathway interlinks with the Wnt pathway that involves proteins like β-catenin affecting the regulation of gene transcription. The interplay between Notch1 and these pathways is fundamental in determining outcomes in cell proliferation and differentiation emphasizing the interconnected nature of signaling networks.

Notch1 is associated with T-cell acute lymphoblastic leukemia and breast cancer. Altered Notch1 signaling often through gain-of-function mutations can drive oncogenesis by disrupting normal cell differentiation and promoting uncontrolled proliferation. In T-cell acute lymphoblastic leukemia aberrant activation of Notch1 leads to increased expression of target genes working closely with related proteins like c-Myc. In breast cancer dysregulation of Notch1 signaling may facilitate tumor growth and metastasis indicating its role as a therapeutic target.

Specifications

Form

Liquid

General info

Function

Functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. Involved in angiogenesis; negatively regulates endothelial cell proliferation and migration and angiogenic sprouting. Involved in the maturation of both CD4(+) and CD8(+) cells in the thymus. Important for follicular differentiation and possibly cell fate selection within the follicle. During cerebellar development, functions as a receptor for neuronal DNER and is involved in the differentiation of Bergmann glia. Represses neuronal and myogenic differentiation. May play an essential role in postimplantation development, probably in some aspect of cell specification and/or differentiation. May be involved in mesoderm development, somite formation and neurogenesis. May enhance HIF1A function by sequestering HIF1AN away from HIF1A. Required for the THBS4 function in regulating protective astrogenesis from the subventricular zone (SVZ) niche after injury. Involved in determination of left/right symmetry by modulating the balance between motile and immotile (sensory) cilia at the left-right organiser (LRO).

Sequence similarities

Belongs to the NOTCH family.

Post-translational modifications

Synthesized in the endoplasmic reticulum as an inactive form which is proteolytically cleaved by a furin-like convertase in the trans-Golgi network before it reaches the plasma membrane to yield an active, ligand-accessible form (By similarity). Cleavage results in a C-terminal fragment N(TM) and a N-terminal fragment N(EC). Following ligand binding, it is cleaved by ADAM17 to yield a membrane-associated intermediate fragment called notch extracellular truncation (NEXT) (PubMed:24226769). Following endocytosis, this fragment is then cleaved by one of the catalytic subunits of gamma-secretase (PSEN1 or PSEN2), to release a Notch-derived peptide containing the intracellular domain (NICD) from the membrane (PubMed:30598546).. Phosphorylated.. O-glycosylated on the EGF-like domains (PubMed:24226769). O-glucosylated at Ser-435 by KDELC1 and KDELC2 (PubMed:30127001). Contains both O-linked fucose and O-linked glucose in the EGF-like domains 11, 12 and 13, which are interacting with the residues on DLL4 (By similarity). O-linked glycosylation by GALNT11 is involved in determination of left/right symmetry: glycosylation promotes activation of NOTCH1, possibly by promoting cleavage by ADAM17, modulating the balance between motile and immotile (sensory) cilia at the left-right organiser (LRO) (PubMed:24226769). MFNG-, RFNG- and LFNG-mediated modification of O-fucose residues at specific EGF-like domains results in inhibition of its activation by JAG1 and enhancement of its activation by DLL1 via an increased binding to DLL1 (By similarity).. Ubiquitinated. Undergoes 'Lys-29'-linked polyubiquitination by ITCH; promotes the lysosomal degradation of non-activated internalized NOTCH1 (PubMed:18628966, PubMed:23886940). Deubiquitination by USP12 is required for transport of internalized non-activated receptor from late endosomes to lysosomes for degradation (PubMed:22778262). Monoubiquitination at Lys-1759 is required for activation by gamma-secretase cleavage, it promotes interaction with AAK1, which stabilizes it. Deubiquitination by EIF3F is necessary for nuclear import of activated Notch (PubMed:24226769).. Hydroxylated at Asn-1955 by HIF1AN. Hydroxylated at Asn-2022 by HIF1AN (By similarity). Hydroxylation reduces affinity for HI1AN and may thus indirectly modulate negative regulation of NICD (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

Functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. Involved in angiogenesis; negatively regulates endothelial cell proliferation and migration and angiogenic sprouting. Involved in the maturation of both CD4(+) and CD8(+) cells in the thymus. Important for follicular differentiation and possibly cell fate selection within the follicle. During cerebellar development, functions as a receptor for neuronal DNER and is involved in the differentiation of Bergmann glia. Represses neuronal and myogenic differentiation. May play an essential role in postimplantation development, probably in some aspect of cell specification and/or differentiation. May be involved in mesoderm development, somite formation and neurogenesis. May enhance HIF1A function by sequestering HIF1AN away from HIF1A. Required for the THBS4 function in regulating protective astrogenesis from the subventricular zone (SVZ) niche after injury. Involved in determination of left/right symmetry by modulating the balance between motile and immotile (sensory) cilia at the left-right organiser (LRO).
See full target information NOTCH1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com