JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114183

Recombinant Human NOX2/gp91phox protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NOX2/gp91phox protein (GST tag N-Terminus) is a Human protein, in the 120 to 171 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

NOX2, CYBB, NADPH oxidase 2, CGD91-phox, Cytochrome b(558) subunit beta, Cytochrome b-245 heavy chain, Heme-binding membrane glycoprotein gp91phox, Neutrophil cytochrome b 91 kDa polypeptide, Superoxide-generating NADPH oxidase heavy chain subunit, gp91-1, gp91-phox, p22 phagocyte B-cytochrome, Cytochrome b558 subunit beta

1 Images
SDS-PAGE - Recombinant Human NOX2/gp91phox protein (GST tag N-Terminus) (AB114183)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NOX2/gp91phox protein (GST tag N-Terminus) (AB114183)

ab114183 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

P04839

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein)</p>" } } }

Sequence info

[{"sequence":"LFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAV","proteinLength":null,"predictedMolecularWeight":"31.35 kDa","actualMolecularWeight":null,"aminoAcidEnd":171,"aminoAcidStart":120,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P04839","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NOX2 also known as gp91phox or cybb is a membrane-bound protein that plays an important role in the production of reactive oxygen species (ROS). This protein functions as a catalytic component of the NADPH oxidase complex which is primarily found in phagocytes like neutrophils and macrophages. The NOX2 protein has a molecular weight of approximately 91 kDa. It is expressed prominently in the cell membranes of these immune cells where it participates in the body's defense mechanisms.
Biological function summary

NOX2 participates in the generation of superoxide by using NADPH as a substrate an essential function performed by the multi-subunit NADPH oxidase complex. This process helps in the formation of microbicidal ROS which neutrophils and macrophages require for killing pathogens. The gp91phox component NOX2's alternate name partners with p22phox and other cytosolic subunits like p47phox and p67phox to form the fully active enzyme complex. This emphasizes NOX2's role in the immune system's oxidative burst an important antimicrobial response.

Pathways

NOX2 is an integral part of the oxidative burst pathway important in host defense. Its activity connects with the MAPK signaling pathway which can be activated by the presence of ROS produced by NOX2. This pathway involves proteins such as ERK JNK and p38 MAPKs which are related through the signaling events that lead to diverse cellular responses including inflammation and stress responses.

NOX2 dysregulation is associated with chronic granulomatous disease (CGD) a condition characterized by a compromised ability of phagocytes to produce ROS leading to recurrent infections. Additionally NOX2 activity links with cardiovascular diseases where its overproduction of ROS can cause oxidative stress contributing to atherosclerosis. The functioning of p22phox another protein in the NADPH oxidase complex becomes particularly relevant in these contexts as it partners with NOX2 to generate the harmful superoxide in such diseases.

Specifications

Form

Liquid

General info

Function

Catalytic subunit of the phagocyte NADPH oxidase complex that mediates the transfer of electrons from cytosolic NADPH to O2 to produce the superoxide anion (O2(-)) (PubMed : 15338276, PubMed : 36241643, PubMed : 36413210, PubMed : 38355798). In the activated complex, electrons are first transferred from NADPH to flavin adenine dinucleotide (FAD) and subsequently transferred via two heme molecules to molecular oxygen, producing superoxide through an outer-sphere reaction (Probable) (PubMed : 38355798). Activation of the NADPH oxidase complex is initiated by the assembly of cytosolic subunits of the NADPH oxidase complex with the core NADPH oxidase complex to form a complex at the plasma membrane or phagosomal membrane (PubMed : 19028840, PubMed : 38355798). This activation process is initiated by phosphorylation dependent binding of the cytosolic NCF1/p47-phox subunit to the C-terminus of CYBA/p22-phox (By similarity). NADPH oxidase complex assembly is impaired through interaction with NRROS (By similarity).

Post-translational modifications

Glycosylated.. Phosphorylated on Ser and Thr residues by PKC during neutrophils activation (PubMed:19028840). Phosphorylation enhances the NADPH oxidase activity and stimulates its interaction with RAC2, NCF2/p67-phox, and NCF1/p47-phox (PubMed:19028840).. Undergoes 'Lys-48'-linked polyubiquitination, likely by RNF145, triggering endoplasmic reticulum-associated degradation.

Product protocols

Target data

Catalytic subunit of the phagocyte NADPH oxidase complex that mediates the transfer of electrons from cytosolic NADPH to O2 to produce the superoxide anion (O2(-)) (PubMed : 15338276, PubMed : 36241643, PubMed : 36413210, PubMed : 38355798). In the activated complex, electrons are first transferred from NADPH to flavin adenine dinucleotide (FAD) and subsequently transferred via two heme molecules to molecular oxygen, producing superoxide through an outer-sphere reaction (Probable) (PubMed : 38355798). Activation of the NADPH oxidase complex is initiated by the assembly of cytosolic subunits of the NADPH oxidase complex with the core NADPH oxidase complex to form a complex at the plasma membrane or phagosomal membrane (PubMed : 19028840, PubMed : 38355798). This activation process is initiated by phosphorylation dependent binding of the cytosolic NCF1/p47-phox subunit to the C-terminus of CYBA/p22-phox (By similarity). NADPH oxidase complex assembly is impaired through interaction with NRROS (By similarity).
See full target information CYBB

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com