JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB87692

Recombinant Human NQO1 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NQO1 protein (His tag N-Terminus) is a Human Full Length protein, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

DIA4, NMOR1, NQO1, NAD(P)H dehydrogenase [quinone] 1, Azoreductase, DT-diaphorase, Menadione reductase, NAD(P)H:quinone oxidoreductase 1, Phylloquinone reductase, Quinone reductase 1, DTD, QR1

1 Images
SDS-PAGE - Recombinant Human NQO1 protein (AB87692)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NQO1 protein (AB87692)

ab87692 on 15% SDS-PAGE (3μg)

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P15559

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P15559","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NQO1 also known as NAD(P)H:quinone oxidoreductase 1 is a cytosolic enzyme involved in two-electron reduction processes. This protein plays a role in detoxification transforming quinones into less reactive and harmful hydroquinones. NQO1 has a molecular weight of approximately 31 kDa and is present in various tissues with high expression in the liver and lungs. Sometimes called DT-diaphorase it contributes to antioxidant protection within cells and assists in the stabilization of other proteins such as p53.
Biological function summary

NQO1 serves a protective function against oxidative stress by reducing quinones and preventing redox cycling that generates reactive oxygen species. Part of a critical network its function integrates with the cellular defense mechanism assisting in maintaining cellular homeostasis. NQO1 helps metabolize xenobiotics and is associated with phase II detoxification working alongside enzymes like glutathione S-transferases but is not part of a complex.

Pathways

NQO1 is an important component of the antioxidant defense pathway participating in the direct enzymatic reduction of quinones protecting cells from oxidative damage. It also interfaces with the KEAP1-NRF2 pathway where the NQO1 gene is regulated by the NRF2 transcription factor that upregulates its expression in response to oxidative stress. NQO1 interlinks with proteins such as p53 through pathways related to apoptotic regulation and cellular stress responses.

Mutations or altered expression of NQO1 have correlations with cancer development and progression notably in liver and lung cancers. This protein's stability influences cancer cell survival particularly under oxidative stress or chemotherapeutic treatments. NQO1 also exhibits links to Alzheimer's disease where its potential role in neuroprotection against oxidative damage draws investigation relating it to proteins like tau and amyloid-beta.

Specifications

Form

Liquid

General info

Function

Flavin-containing quinone reductase that catalyzes two-electron reduction of quinones to hydroquinones using either NADH or NADPH as electron donors. In a ping-pong kinetic mechanism, the electrons are sequentially transferred from NAD(P)H to flavin cofactor and then from reduced flavin to the quinone, bypassing the formation of semiquinone and reactive oxygen species (By similarity) (PubMed : 8999809, PubMed : 9271353). Regulates cellular redox state primarily through quinone detoxification. Reduces components of plasma membrane redox system such as coenzyme Q and vitamin quinones, producing antioxidant hydroquinone forms. In the process may function as superoxide scavenger to prevent hydroquinone oxidation and facilitate excretion (PubMed : 15102952, PubMed : 8999809, PubMed : 9271353). Alternatively, can activate quinones and their derivatives by generating redox reactive hydroquinones with DNA cross-linking antitumor potential (PubMed : 8999809). Acts as a gatekeeper of the core 20S proteasome known to degrade proteins with unstructured regions. Upon oxidative stress, interacts with tumor suppressors TP53 and TP73 in a NADH-dependent way and inhibits their ubiquitin-independent degradation by the 20S proteasome (PubMed : 15687255, PubMed : 28291250).

Sequence similarities

Belongs to the NAD(P)H dehydrogenase (quinone) family.

Product protocols

Target data

Flavin-containing quinone reductase that catalyzes two-electron reduction of quinones to hydroquinones using either NADH or NADPH as electron donors. In a ping-pong kinetic mechanism, the electrons are sequentially transferred from NAD(P)H to flavin cofactor and then from reduced flavin to the quinone, bypassing the formation of semiquinone and reactive oxygen species (By similarity) (PubMed : 8999809, PubMed : 9271353). Regulates cellular redox state primarily through quinone detoxification. Reduces components of plasma membrane redox system such as coenzyme Q and vitamin quinones, producing antioxidant hydroquinone forms. In the process may function as superoxide scavenger to prevent hydroquinone oxidation and facilitate excretion (PubMed : 15102952, PubMed : 8999809, PubMed : 9271353). Alternatively, can activate quinones and their derivatives by generating redox reactive hydroquinones with DNA cross-linking antitumor potential (PubMed : 8999809). Acts as a gatekeeper of the core 20S proteasome known to degrade proteins with unstructured regions. Upon oxidative stress, interacts with tumor suppressors TP53 and TP73 in a NADH-dependent way and inhibits their ubiquitin-independent degradation by the 20S proteasome (PubMed : 15687255, PubMed : 28291250).
See full target information NQO1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com