JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB216216

Recombinant Human Nucleosome protein (Biotin) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Nucleosome protein (Biotin) (His tag N-Terminus) is a Human Full Length protein, in the 2 to 136 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

H2BFQ, HIST2H2BE, H2BC21, Histone H2B type 2-E, H2B-clustered histone 21, Histone H2B-GL105, Histone H2B.q, H2B/q

2 Images
SDS-PAGE - Recombinant Human Nucleosome protein (Biotin) (His tag N-Terminus) (AB216216)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Nucleosome protein (Biotin) (His tag N-Terminus) (AB216216)

SDS-PAGE analysis of ab216216.

SDS-PAGE - Recombinant Human Nucleosome protein (Biotin) (His tag N-Terminus) (AB216216)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Nucleosome protein (Biotin) (His tag N-Terminus) (AB216216)

SDS-PAGE analysis of ab216216.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Conjugation

Biotin

Excitation/Emission
Accession

Q16778

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 20% Glycerol (glycerin, glycerine), 0.32% Tris HCl, 0.03% EDTA, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Storing diluted protein is not recommended, if necessary, use carrier protein (BSA 0.1 – 0.5%).

ab216216 is Human recombinant nucleosomes consisting of 147 bp DNA (PCR) and 2 molecules each of histones H2A, H2B, H3 and H4. Each histone protein has an N-terminal His-tag. Each H2B has a C-terminal Cys added as a biotinylation site. Total histone MW (before biotinylation) = 113.8 kDa

Sequence info

[{"sequence":"ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":136,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P68431","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":130,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q7L7L0","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":126,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q16778","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":103,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P62805","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle|Store in the dark
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Nucleosome is a fundamental unit of chromatin consisting of DNA wrapped around histone proteins. Alternate names include chromatin fibers and DNA-histone complexes. Each nucleosome contains an octamer of histones (two copies each of H2A H2B H3 and H4) with DNA coiled around it measuring about 11 nm in diameter. Nucleosomes are expressed in the nucleus of eukaryotic cells forming the basic structure of chromatin which further compacts to fit within the nucleus.
Biological function summary

Nucleosomes organize and protect the DNA strand modulating access for DNA replication and transcription machinery. Nucleosomes are part of the larger chromatin complex and regulate gene expression by controlling DNA accessibility. Changes in histone modifications within nucleosomes alter chromatin's structure influencing the transcriptional activity of genes. This dynamic alteration is essential for cellular functions such as DNA repair replication and genome stability.

Pathways

Nucleosomes play central roles in the regulation of epigenetic pathways involved in gene expression and silencing. They interact with other proteins like histone-modifying enzymes and chromatin remodelers such as the Polycomb group proteins and the SWI/SNF complexes. These interactions impact pathways like the cell cycle control and DNA damage response coordinating cellular processes to maintain genomic integrity and respond to environmental signals.

Nucleosomes have significant links to cancer and autoimmune diseases. Alterations in nucleosome positioning or histone modifications can lead to aberrant gene expression contributing to oncogenesis. In cancers changes in histone modifications can activate oncogenes or silence tumor suppressor genes. Nucleosomes are also implicated in autoimmune disorders such as systemic lupus erythematosus where the immune system may produce antibodies against nucleosome components. Histones or nucleosomes released during cell death can exacerbate the autoimmune response.

Specifications

Form

Liquid

General info

Function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.

Sequence similarities

Belongs to the histone H2B family.

Post-translational modifications

Monoubiquitination at Lys-35 (H2BK34Ub) by the MSL1/MSL2 dimer is required for histone H3 'Lys-4' (H3K4me) and 'Lys-79' (H3K79me) methylation and transcription activation at specific gene loci, such as HOXA9 and MEIS1 loci. Similarly, monoubiquitination at Lys-121 (H2BK120Ub) by the RNF20/40 complex gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation. It also functions cooperatively with the FACT dimer to stimulate elongation by RNA polymerase II. H2BK120Ub also acts as a regulator of mRNA splicing: deubiquitination by USP49 is required for efficient cotranscriptional splicing of a large set of exons.. Phosphorylation at Ser-37 (H2BS36ph) by AMPK in response to stress promotes transcription (By similarity). Phosphorylated on Ser-15 (H2BS14ph) by STK4/MST1 during apoptosis; which facilitates apoptotic chromatin condensation (PubMed:12757711). Also phosphorylated on Ser-15 in response to DNA double strand breaks (DSBs), and in correlation with somatic hypermutation and immunoglobulin class-switch recombination.. GlcNAcylation at Ser-113 promotes monoubiquitination of Lys-121. It fluctuates in response to extracellular glucose, and associates with transcribed genes (By similarity).. ADP-ribosylated by PARP1 or PARP2 on Ser-7 (H2BS6ADPr) in response to DNA damage (PubMed:34874266). H2BS6ADPr promotes recruitment of CHD1L (PubMed:34874266). Mono-ADP-ribosylated on Glu-3 (H2BE2ADPr) by PARP3 in response to single-strand breaks (PubMed:27530147). Poly ADP-ribosylation on Glu-36 (H2BE35ADPr) by PARP1 regulates adipogenesis: it inhibits phosphorylation at Ser-37 (H2BS36ph), thereby blocking expression of pro-adipogenetic genes (By similarity).. Crotonylation (Kcr) is specifically present in male germ cells and marks testis-specific genes in post-meiotic cells, including X-linked genes that escape sex chromosome inactivation in haploid cells. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. It is also associated with post-meiotically activated genes on autosomes.. Lactylated in macrophages by EP300/P300 by using lactoyl-CoA directly derived from endogenous or exogenous lactate, leading to stimulates gene transcription.

Subcellular localisation

Nucleus

Product protocols

Target data

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.
See full target information H2BC21

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com