JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB104669

Recombinant Human NUDT21/CFIM25 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human NUDT21/CFIM25 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 227 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

CFIM25, CPSF25, CPSF5, NUDT21, Cleavage and polyadenylation specificity factor subunit 5, Cleavage and polyadenylation specificity factor 25 kDa subunit, Cleavage factor Im complex 25 kDa subunit, Nucleoside diphosphate-linked moiety X motif 21, Nudix hydrolase 21, Pre-mRNA cleavage factor Im 68 kDa subunit, CPSF 25 kDa subunit, CFIm25, Nudix motif 21

1 Images
SDS-PAGE - Recombinant Human NUDT21/CFIM25 protein (His tag N-Terminus) (AB104669)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NUDT21/CFIM25 protein (His tag N-Terminus) (AB104669)

15% SDS-PAGE showing ab104669 at approximately 28.3kDa (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

O43809

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.0308% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as NUDT21

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN","proteinLength":"Full Length","predictedMolecularWeight":"28.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":227,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O43809","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NUDT21 also known as CFIm25 is a protein important for RNA processing. This protein is part of the cleavage factor Im complex and plays an important role in pre-mRNA polyadenylation. NUDT21 is about 25 kDa in molecular weight and expresses widely across human tissues. It is especially abundant in the brain and liver indicating important roles in these areas.
Biological function summary

NUDT21 acts as a component of the cleavage factor I which is essential for mRNA polyadenylation. This protein ensures proper 3’-end processing of pre-mRNA by interacting with other CFIm complex components like CPSF and CstF. This interaction is necessary for the regulation of mRNA stability and eventual translation into proteins. The correct functioning of NUDT21 is necessary for the maintenance of gene expression.

Pathways

NUDT21 is part of the mRNA 3'-end processing pathway. This pathway is critical for proper gene expression affecting mRNA synthesis and degradation rates. Within this pathway NUDT21 works closely with proteins such as CPSF6 and CPSF7 facilitating the assembly of the mRNA cleavage complex. The pathway influences general RNA growth and stability impacting numerous cellular processes.

Abnormalities in NUDT21 are linked to neurological disorders and cancer. Loss of function or altered expression is connected to intellectual disability affecting neural development and cognitive abilities. In the context of cancer NUDT21 levels can influence tumor growth and progression. Changes in NUDT21 may cause dysregulation in associated proteins like CPSF6 further complicating these diseases.

Specifications

Form

Liquid

Additional notes

ab104669 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

Component of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3'-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs (PubMed : 14690600, PubMed : 15937220, PubMed : 17024186, PubMed : 17098938, PubMed : 29276085, PubMed : 8626397, PubMed : 9659921). CFIm contributes to the recruitment of multiprotein complexes on specific sequences on the pre-mRNA 3'-end, so called cleavage and polyadenylation signals (pA signals) (PubMed : 14690600, PubMed : 17024186, PubMed : 8626397, PubMed : 9659921). Most pre-mRNAs contain multiple pA signals, resulting in alternative cleavage and polyadenylation (APA) producing mRNAs with variable 3'-end formation (PubMed : 17098938, PubMed : 23187700, PubMed : 29276085). The CFIm complex acts as a key regulator of cleavage and polyadenylation site choice during APA through its binding to 5'-UGUA-3' elements localized in the 3'-untranslated region (UTR) for a huge number of pre-mRNAs (PubMed : 17098938, PubMed : 20695905, PubMed : 29276085). NUDT21/CPSF5 activates indirectly the mRNA 3'-processing machinery by recruiting CPSF6 and/or CPSF7 (PubMed : 29276085). Binds to 5'-UGUA-3' elements localized upstream of pA signals that act as enhancers of pre-mRNA 3'-end processing (PubMed : 14690600, PubMed : 15169763, PubMed : 17024186, PubMed : 20479262, PubMed : 22813749, PubMed : 8626397). The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA (PubMed : 20479262, PubMed : 21295486). Plays a role in somatic cell fate transitions and pluripotency by regulating widespread changes in gene expression through an APA-dependent function (By similarity). Binds to chromatin (By similarity). Binds to, but does not hydrolyze mono- and di-adenosine nucleotides (PubMed : 18445629).

Sequence similarities

Belongs to the Nudix hydrolase family. CPSF5 subfamily.

Post-translational modifications

Acetylated mainly by p300/CBP, recruited to the complex by CPSF6. Acetylation decreases interaction with PAPAO. Deacetylated by the class I/II HDACs, HDAC1, HDAC3 and HDAC10, and by the class III HDACs, SIRT1 and SIRT2.

Subcellular localisation

Nucleus

Product protocols

Target data

Component of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3'-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs (PubMed : 14690600, PubMed : 15937220, PubMed : 17024186, PubMed : 17098938, PubMed : 29276085, PubMed : 8626397, PubMed : 9659921). CFIm contributes to the recruitment of multiprotein complexes on specific sequences on the pre-mRNA 3'-end, so called cleavage and polyadenylation signals (pA signals) (PubMed : 14690600, PubMed : 17024186, PubMed : 8626397, PubMed : 9659921). Most pre-mRNAs contain multiple pA signals, resulting in alternative cleavage and polyadenylation (APA) producing mRNAs with variable 3'-end formation (PubMed : 17098938, PubMed : 23187700, PubMed : 29276085). The CFIm complex acts as a key regulator of cleavage and polyadenylation site choice during APA through its binding to 5'-UGUA-3' elements localized in the 3'-untranslated region (UTR) for a huge number of pre-mRNAs (PubMed : 17098938, PubMed : 20695905, PubMed : 29276085). NUDT21/CPSF5 activates indirectly the mRNA 3'-processing machinery by recruiting CPSF6 and/or CPSF7 (PubMed : 29276085). Binds to 5'-UGUA-3' elements localized upstream of pA signals that act as enhancers of pre-mRNA 3'-end processing (PubMed : 14690600, PubMed : 15169763, PubMed : 17024186, PubMed : 20479262, PubMed : 22813749, PubMed : 8626397). The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA (PubMed : 20479262, PubMed : 21295486). Plays a role in somatic cell fate transitions and pluripotency by regulating widespread changes in gene expression through an APA-dependent function (By similarity). Binds to chromatin (By similarity). Binds to, but does not hydrolyze mono- and di-adenosine nucleotides (PubMed : 18445629).
See full target information NUDT21

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Cell reports 28:2795-2806.e3 PubMed31509743

2019

RNA Binding Protein CELF2 Regulates Signal-Induced Alternative Polyadenylation by Competing with Enhancers of the Polyadenylation Machinery.

Applications

Unspecified application

Species

Unspecified reactive species

Rakesh Chatrikhi,Michael J Mallory,Matthew R Gazzara,Laura M Agosto,Wandi S Zhu,Adam J Litterman,K Mark Ansel,Kristen W Lynch
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com