JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114324

Recombinant Human NuMA protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NuMA protein (GST tag N-Terminus) is a Human Fragment protein, in the 200 to 306 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

NMP22, NUMA, NUMA1, Nuclear mitotic apparatus protein 1, Nuclear matrix protein-22, Nuclear mitotic apparatus protein, SP-H antigen, NMP-22, NuMA protein

1 Images
SDS-PAGE - Recombinant Human NuMA protein (GST tag N-Terminus) (AB114324)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NuMA protein (GST tag N-Terminus) (AB114324)

SDS-PAGE analysis of ab114324 on a 12.5% gel stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

Q14980

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(for recombinant protein).</p>" } } }

Sequence info

[{"sequence":"SPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQDLKTEK","proteinLength":"Fragment","predictedMolecularWeight":"37.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":306,"aminoAcidStart":200,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q14980","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NuMA also known as "nuclear mitotic apparatus protein" is a large protein with a mass of approximately 250 kDa. It localizes in the nucleus and becomes highly concentrated at the spindle poles during mitosis. NuMA proteins appear in a variety of cells especially in cells undergoing division. Researchers often refer to it by alternate names such as "anti NuMA" when discussing its interactions in cellular contexts. Scientists have developed products such as NuMA polyclonal antibodies to study this protein's function.
Biological function summary

The protein plays an important role in the organization of the mitotic spindle during cell division. It ensures that the spindle microtubules are correctly aligned and positioned. NuMA acts within a complex that includes dynein and dynactin facilitating proper chromosomal segregation. These actions are critical for maintaining genomic stability through accurate cell division.

Pathways

NuMA's involvement in the cell cycle is significant especially within the mitotic checkpoint control pathways. It interacts closely with proteins like pericentrin and LGN ensuring the efficient completion of mitosis. These interactions confirm the protein's importance in pathway regulation particularly during transition phases within the cell cycle.

Abnormal NuMA function has associations with cancer and certain genetic disorders like microcephaly. Changes in NuMA expression or malfunction can disrupt normal spindle formation leading to chromosomal instability a common hallmark of cancer cells. Its interaction with proteins like p53 further connects it to oncogenic processes suggesting that understanding NuMA's pathways could contribute to therapeutic strategies.

Specifications

Form

Liquid

General info

Function

Microtubule (MT)-binding protein that plays a role in the formation and maintenance of the spindle poles and the alignement and the segregation of chromosomes during mitotic cell division (PubMed : 17172455, PubMed : 19255246, PubMed : 24996901, PubMed : 26195665, PubMed : 27462074, PubMed : 7769006). Functions to tether the minus ends of MTs at the spindle poles, which is critical for the establishment and maintenance of the spindle poles (PubMed : 11956313, PubMed : 12445386). Plays a role in the establishment of the mitotic spindle orientation during metaphase and elongation during anaphase in a dynein-dynactin-dependent manner (PubMed : 23870127, PubMed : 24109598, PubMed : 24996901, PubMed : 26765568). In metaphase, part of a ternary complex composed of GPSM2 and G(i) alpha proteins, that regulates the recruitment and anchorage of the dynein-dynactin complex in the mitotic cell cortex regions situated above the two spindle poles, and hence regulates the correct oritentation of the mitotic spindle (PubMed : 22327364, PubMed : 23027904, PubMed : 23921553). During anaphase, mediates the recruitment and accumulation of the dynein-dynactin complex at the cell membrane of the polar cortical region through direct association with phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2), and hence participates in the regulation of the spindle elongation and chromosome segregation (PubMed : 22327364, PubMed : 23921553, PubMed : 24371089, PubMed : 24996901). Binds also to other polyanionic phosphoinositides, such as phosphatidylinositol 3-phosphate (PIP), lysophosphatidic acid (LPA) and phosphatidylinositol triphosphate (PIP3), in vitro (PubMed : 24371089, PubMed : 24996901). Also required for proper orientation of the mitotic spindle during asymmetric cell divisions (PubMed : 21816348). Plays a role in mitotic MT aster assembly (PubMed : 11163243, PubMed : 11229403, PubMed : 12445386). Involved in anastral spindle assembly (PubMed : 25657325). Positively regulates TNKS protein localization to spindle poles in mitosis (PubMed : 16076287). Highly abundant component of the nuclear matrix where it may serve a non-mitotic structural role, occupies the majority of the nuclear volume (PubMed : 10075938). Required for epidermal differentiation and hair follicle morphogenesis (By similarity).

Post-translational modifications

Phosphorylation and dephosphorylation on Thr-2055 regulates the extent of cortical NUMA1 and the dynein-dynactin complex localization during mitotic metaphase and anaphase (PubMed:23921553). In metaphase, phosphorylation on Thr-2055 occurs in a kinase CDK1-dependent manner; this phosphorylation maintains low levels of cortical dynein-dynactin complex at metaphase, and hence proper spindle positioning (PubMed:23921553, PubMed:24371089, PubMed:7769006). In anaphase, dephosphorylated on Thr-2055 by phosphatase PPP2CA; this dephosphorylation stimulates its membrane association and with the dynein-dynactin complex its enrichment at the cell cortex, and hence robust spindle elongation (PubMed:23921553, PubMed:24371089). Probably also phosphorylated on Thr-2015 and Ser-2087 by CDK1; these phosphorylations may regulate its cell cortex recruitment during metaphase and anaphase (PubMed:23870127). Phosphorylated on Thr-1047, Ser-1769, Ser-1772, Ser-1789 and Ser-1834 by PLK1; these phosphorylations induce cortical dynein-dynactin complex dissociation from the NUMA1-GPSM2 complex and negatively regulates cortical dynein-dynactin complex localization (PubMed:22327364).. ADP-ribosylated by TNKS at the onset of mitosis; ADP-ribosylation is not required for its localization to spindle poles (PubMed:16076287).. O-glycosylated during cytokinesis at sites identical or close to phosphorylation sites, this interferes with the phosphorylation status (PubMed:20068230).. Ubiquitinated with 'Lys-63'-linked polyubiquitin chains. Deubiquitination by the BRISC complex is important for the incorporation of NUMA1 into mitotic spindle poles and normal spindle pole function, probably by modulating interactions between NUMA1, dynein-dynactin complex and importin-beta.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Microtubule (MT)-binding protein that plays a role in the formation and maintenance of the spindle poles and the alignement and the segregation of chromosomes during mitotic cell division (PubMed : 17172455, PubMed : 19255246, PubMed : 24996901, PubMed : 26195665, PubMed : 27462074, PubMed : 7769006). Functions to tether the minus ends of MTs at the spindle poles, which is critical for the establishment and maintenance of the spindle poles (PubMed : 11956313, PubMed : 12445386). Plays a role in the establishment of the mitotic spindle orientation during metaphase and elongation during anaphase in a dynein-dynactin-dependent manner (PubMed : 23870127, PubMed : 24109598, PubMed : 24996901, PubMed : 26765568). In metaphase, part of a ternary complex composed of GPSM2 and G(i) alpha proteins, that regulates the recruitment and anchorage of the dynein-dynactin complex in the mitotic cell cortex regions situated above the two spindle poles, and hence regulates the correct oritentation of the mitotic spindle (PubMed : 22327364, PubMed : 23027904, PubMed : 23921553). During anaphase, mediates the recruitment and accumulation of the dynein-dynactin complex at the cell membrane of the polar cortical region through direct association with phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2), and hence participates in the regulation of the spindle elongation and chromosome segregation (PubMed : 22327364, PubMed : 23921553, PubMed : 24371089, PubMed : 24996901). Binds also to other polyanionic phosphoinositides, such as phosphatidylinositol 3-phosphate (PIP), lysophosphatidic acid (LPA) and phosphatidylinositol triphosphate (PIP3), in vitro (PubMed : 24371089, PubMed : 24996901). Also required for proper orientation of the mitotic spindle during asymmetric cell divisions (PubMed : 21816348). Plays a role in mitotic MT aster assembly (PubMed : 11163243, PubMed : 11229403, PubMed : 12445386). Involved in anastral spindle assembly (PubMed : 25657325). Positively regulates TNKS protein localization to spindle poles in mitosis (PubMed : 16076287). Highly abundant component of the nuclear matrix where it may serve a non-mitotic structural role, occupies the majority of the nuclear volume (PubMed : 10075938). Required for epidermal differentiation and hair follicle morphogenesis (By similarity).
See full target information NUMA1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com