JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114315

Recombinant Human NUR77 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human NUR77 protein is a Human Full Length protein, in the 1 to 598 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

GFRP1, HMR, NAK1, NR4A1, Nuclear receptor subfamily 4immunitygroup A member 1, Early response protein NAK1, Nuclear hormone receptor NUR/77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, ST-59, Testicular receptor 3, Nur77

1 Images
SDS-PAGE - Recombinant Human NUR77 protein (AB114315)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human NUR77 protein (AB114315)

SDS-PAGE analysis of ab114315 on a 12.5% gel stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

P22736

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF","proteinLength":"Full Length","predictedMolecularWeight":"91.85 kDa","actualMolecularWeight":null,"aminoAcidEnd":598,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P22736","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

NUR77 also known as NR4A1 is an orphan nuclear receptor and transcription factor with a molecular mass of around 65 kDa. This protein plays an important role in mediating gene expression by binding DNA at specific response elements. It is expressed in various tissues including the thymus spleen and central nervous system. NUR77 achieves its mechanical function by regulating gene transcription involved in cell proliferation apoptosis and metabolism.
Biological function summary

The functions of NUR77 impact multiple cellular processes that are essential for maintaining cellular homeostasis. As part of its biological roles NUR77 can form complexes with other nuclear receptors and influence gene expression. It is particularly significant in T-cell receptor signaling where it influences the balance between cell survival and cell death. This modulation helps in the regulation of immune functions and cellular development.

Pathways

NUR77 integrates into the MAPK signaling and apoptosis pathways. It interacts with proteins such as Bcl-2 and p53 facilitating cellular responses to stress and developmental cues. In the MAPK pathway NUR77 can modulate transcriptional activities affecting cell proliferation and differentiation while in apoptotic pathways it contributes to the regulation of programmed cell death making it a critical modulator in these contexts.

NUR77 has been associated with cancer and atherosclerosis. Its role in apoptosis makes it a point of interest in cancer research where altered NUR77 expression can influence tumor growth and resistance to therapy. In the context of atherosclerosis aberrant activity of NUR77 affects lipid metabolism and inflammation. Through its link to pathways involving Bcl-2 and p53 NUR77 remains a significant target in both therapeutic research and disease management.

Specifications

Form

Liquid

General info

Function

Orphan nuclear receptor. Binds the NGFI-B response element (NBRE) 5'-AAAGGTCA-3' (PubMed : 18690216, PubMed : 8121493, PubMed : 9315652). Binds 9-cis-retinoic acid outside of its ligand-binding (NR LBD) domain (PubMed : 18690216). Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation (PubMed : 22983157). Regulates the inflammatory response in macrophages by regulating metabolic adaptations during inflammation, including repressing the transcription of genes involved in the citric acid cycle (TCA) (By similarity). Inhibits NF-kappa-B signaling by binding to low-affinity NF-kappa-B binding sites, such as at the IL2 promoter (PubMed : 15466594). May act concomitantly with NR4A2 in regulating the expression of delayed-early genes during liver regeneration (By similarity). Plays a role in the vascular response to injury (By similarity).. In the cytosol, upon its detection of both bacterial lipopolysaccharide (LPS) and NBRE-containing mitochondrial DNA released by GSDMD pores during pyroptosis, it promotes non-canonical NLRP3 inflammasome activation by stimulating association of NLRP3 and NEK7.

Sequence similarities

Belongs to the nuclear hormone receptor family. NR4 subfamily.

Post-translational modifications

Phosphorylated at Ser-351 by RPS6KA1 and RPS6KA3 in response to mitogenic or stress stimuli.. Acetylated by p300/CBP, acetylation increases stability. Deacetylated by HDAC1.

Subcellular localisation

Nucleus

Product protocols

Target data

Orphan nuclear receptor. Binds the NGFI-B response element (NBRE) 5'-AAAGGTCA-3' (PubMed : 18690216, PubMed : 8121493, PubMed : 9315652). Binds 9-cis-retinoic acid outside of its ligand-binding (NR LBD) domain (PubMed : 18690216). Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation (PubMed : 22983157). Regulates the inflammatory response in macrophages by regulating metabolic adaptations during inflammation, including repressing the transcription of genes involved in the citric acid cycle (TCA) (By similarity). Inhibits NF-kappa-B signaling by binding to low-affinity NF-kappa-B binding sites, such as at the IL2 promoter (PubMed : 15466594). May act concomitantly with NR4A2 in regulating the expression of delayed-early genes during liver regeneration (By similarity). Plays a role in the vascular response to injury (By similarity).. In the cytosol, upon its detection of both bacterial lipopolysaccharide (LPS) and NBRE-containing mitochondrial DNA released by GSDMD pores during pyroptosis, it promotes non-canonical NLRP3 inflammasome activation by stimulating association of NLRP3 and NEK7.
See full target information NR4A1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com