JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB87759

Recombinant Human OAS1 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human OAS1 protein (His tag N-Terminus) is a Human Full Length protein, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

OIAS, OAS1, 2'-5'-oligoadenylate synthase 1, (2-5')oligo(A) synthase 1, 2-5A synthase 1, E18/E16, p46/p42 OAS

1 Images
SDS-PAGE - Recombinant Human OAS1 protein (His tag N-Terminus) (AB87759)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human OAS1 protein (His tag N-Terminus) (AB87759)

15% SDS-PAGE analysis of 3μg ab87759.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P00973

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Endotoxin level: < 1.0 EU per 1 μg of protein (determined by LAL method).

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P00973","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The OAS1 protein also known as 2'-5'-oligoadenylate synthetase 1 plays an important role in the antiviral response of the body. It has a molecular mass of approximately 42 kDa. This protein is expressed in various tissues including the liver lungs and heart. OAS1 is part of a family of interferon-induced enzymes that synthesize 2'-5'-linked oligoadenylates which are important for cellular defense mechanisms against viral infections.
Biological function summary

The creation of 2'-5'-linked oligoadenylates by OAS1 is essential in activating RNase L an enzyme that degrades viral and cellular RNA to impede viral replication. OAS1 does not operate as part of a larger protein complex but functions independently to mediate antiviral activities. It has been observed that upon viral infection the levels of OAS1 increase enhancing the interferon response and cytokine signaling.

Pathways

OAS1 plays a significant role in the interferon signaling pathway and innate immune response pathways. Within these pathways OAS1 interacts with other proteins such as RNase L and is also associated with STAT1 a critical mediator of the cellular response to interferons. The function of OAS1 within these pathways highlights its importance in modulating immune responses to pathogens.

OAS1 has been linked to conditions such as viral infections and autoimmune diseases. Its role in viral infections involves the detection and degradation of viral RNA thereby limiting viral proliferation. The interaction of OAS1 with RNase L is important in this process. In autoimmune disorders certain variants of OAS1 can alter immune function potentially contributing to abnormal immune responses and disease progression.

Specifications

Form

Liquid

Additional notes

ab87759 is purified using conventional chromatography techniques.

General info

Function

Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response (PubMed : 34581622). In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication (PubMed : 34145065, PubMed : 34581622). Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L.. Isoform p46. When prenylated at C-terminal, acts as a double-stranded RNA (dsRNA) sensor specifically targeted to membranous replicative organelles in SARS coronavirus-2/SARS-CoV-2 infected cells where it binds to dsRNA structures in the SARS-CoV-2 5'-UTR and initiates a potent block to SARS-CoV-2 replication. Recognizes short stretches of dsRNA and activates RNase L. The binding is remarkably specific, with two conserved stem loops in the SARS-CoV-2 5'- untranslated region (UTR) constituting the principal viral target (PubMed : 34581622). The same mechanism is necessary to initiate a block to cardiovirus EMCV (PubMed : 34581622).. Isoform p42. Not prenylated at C-terminal, is diffusely localized and unable to initiate a detectable block to SARS-CoV-2 replication.

Sequence similarities

Belongs to the 2-5A synthase family.

Post-translational modifications

Isoform p46. Prenylated at C-terminal. C-terminal prenylation is necessary to initiate a block to SARS-CoV-2 and is associated with protection from severe COVID-1. The prenylated form is targeted to perinuclear structures rich in viral dsRNA, whereas the non-prenylated form is diffusely localized and unable to initiate a detectable block to SARS-CoV-2 replication (Probable). C-terminal prenylation is also necessary to initiate a block to cardiovirus EMCV (Probable).. Isoform p42. Not prenylated at C-terminal. The non-prenylated form is diffusely localized and unable to initiate a detectable block to SARS-CoV-2 replication.

Subcellular localisation

Mitochondrion

Product protocols

Target data

Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response (PubMed : 34581622). In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication (PubMed : 34145065, PubMed : 34581622). Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L.. Isoform p46. When prenylated at C-terminal, acts as a double-stranded RNA (dsRNA) sensor specifically targeted to membranous replicative organelles in SARS coronavirus-2/SARS-CoV-2 infected cells where it binds to dsRNA structures in the SARS-CoV-2 5'-UTR and initiates a potent block to SARS-CoV-2 replication. Recognizes short stretches of dsRNA and activates RNase L. The binding is remarkably specific, with two conserved stem loops in the SARS-CoV-2 5'- untranslated region (UTR) constituting the principal viral target (PubMed : 34581622). The same mechanism is necessary to initiate a block to cardiovirus EMCV (PubMed : 34581622).. Isoform p42. Not prenylated at C-terminal, is diffusely localized and unable to initiate a detectable block to SARS-CoV-2 replication.
See full target information OAS1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Methods in molecular biology (Clifton, N.J.) 2609:3-21 PubMed36515826

2022

Fluorescence-Based Analyses of Poly(ADP-Ribose) Length by Gel Electrophoresis, High-Performance Liquid Chromatography, and Capillary Electrophoresis.

Applications

Unspecified application

Species

Unspecified reactive species

Mohsen Badiee,Audrey Boutonnet,Dat Phan,Anthony K L Leung
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com