JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB270077

Recombinant human Oncostatin M/OSM protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Oncostatin M/OSM protein (Active) is a Human Full Length protein, in the 26 to 221 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

View Alternative Names

Oncostatin-M, OSM

5 Images
Functional Studies - Recombinant human Oncostatin M/OSM protein (Active) (AB270077)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Oncostatin M/OSM protein (Active) (AB270077)

Fully biologically active when compared to standard. Determined by the dose dependant proliferation of TF-1 cell line.

ED50 is ≤ 0.2ng/mL, corresponding to a specific activity of 5.00 x 106 units/mg.

Mass Spectrometry - Recombinant human Oncostatin M/OSM protein (Active) (AB270077)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human Oncostatin M/OSM protein (Active) (AB270077)

(M - 2Arg) + 0.8 Da (expected mass after Arg loss due to transpeptidation 21896 Da; +16 Da : Hydroxylation/Oxidation, +32 Da : dioxidation; +203 Da HexNAc, + 365 Da Hex(1)HexNAc(1).

Calc MW is 22208.41 Da.

Mass Spectrometry - Recombinant human Oncostatin M/OSM protein (Active) (AB270077)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human Oncostatin M/OSM protein (Active) (AB270077)

(M - 2Arg) + 0.8 Da (expected mass after Arg loss due to transpeptidation 21896 Da; +16 Da : Hydroxylation/Oxidation, +32 Da : dioxidation; +203 Da HexNAc, + 365 Da Hex(1)HexNAc(1)

Calc MW is 22208.41 Da.

SDS-PAGE - Recombinant human Oncostatin M/OSM protein (Active) (AB270077)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Oncostatin M/OSM protein (Active) (AB270077)

SDS-PAGE - Recombinant human Oncostatin M/OSM protein (Active) (ab270077).

Purity ≥95%.

HPLC - Recombinant human Oncostatin M/OSM protein (Active) (AB270077)
  • HPLC

Supplier Data

HPLC - Recombinant human Oncostatin M/OSM protein (Active) (AB270077)

Purity by HPLC ≥95%.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS, Cell Culture, Mass Spec, HPLC, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. Determined by the dose dependant proliferation of TF-1 cell line.

ED50 is ≤ 0.2ng/mL, corresponding to a specific activity of 5.00 x 106 units/mg.

Accession

P13725

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute with Phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment.

Sequence info

[{"sequence":"AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR","proteinLength":"Full Length","predictedMolecularWeight":"22.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":221,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P13725","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
-20°C|Ambient
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Oncostatin M (OSM) also known as Oncostatin M protein or OSM protein is a cytokine with significant roles in inflammation and hematopoiesis. This protein weighs around 28 kDa and is expressed mainly in activated T cells monocytes and macrophages. It interacts with specific receptors on the cell surface to transmit signals that regulate cell growth and function. Oncostatin M is part of the interleukin-6 (IL-6) family contributing to various cellular processes.
Biological function summary

Oncostatin M modulates a range of cellular activities including cell proliferation differentiation and apoptosis. This cytokine affects diverse cell types such as fibroblasts endothelial cells and epithelial cells showing particular influence in processes like tissue remodeling and immune response. It acts as a monomer and does not need assembly into a larger complex to exert its function. Its ability to trigger gene expression differentiates it from other closely related cytokines.

Pathways

Oncostatin M involves itself in significant pathways like the JAK/STAT signaling pathway and the MAPK pathway. Through these pathways it promotes signal transduction essential for immune regulation and cellular response to external stimuli. OSM interacts with proteins like the gp130 receptor a common signaling component for cytokine receptors in its family and influences downstream effectors involved in these pathways.

Oncostatin M associates itself with inflammatory diseases such as rheumatoid arthritis and cardiovascular disorders. Its elevated levels in pathological conditions highlight its role in exacerbating inflammatory responses. In rheumatoid arthritis OSM promotes synovial inflammation while in cardiovascular diseases it may influence vascular remodeling. Connections to inflammatory proteins such as IL-6 further highlight its part in driving disease pathogenesis making it an intriguing target for therapeutic intervention.

Specifications

Form

Lyophilized

Additional notes

Purity =95% by HPLC.

General info

Function

Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIFR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration (By similarity).

Sequence similarities

Belongs to the LIF/OSM family.

Post-translational modifications

Propeptide processing is not important for receptor binding activity but may be important growth-inhibitory activity.

Product protocols

Target data

Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIFR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration (By similarity).
See full target information OSM

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com