JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152232

Recombinant Human Osteocalcin protein (GST tag N-Terminus)

4

(1 Review)

|

(0 Publication)

Recombinant Human Osteocalcin protein (GST tag N-Terminus) is a Human Full Length protein, in the 52 to 100 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, BGP, BGLAP

1 Images
SDS-PAGE - Recombinant Human Osteocalcin protein (GST tag N-Terminus) (AB152232)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Osteocalcin protein (GST tag N-Terminus) (AB152232)

12.5% SDS-PAGE analysis of ab152232 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

P02818

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV","proteinLength":"Full Length","predictedMolecularWeight":"31.13 kDa","actualMolecularWeight":null,"aminoAcidEnd":100,"aminoAcidStart":52,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P02818","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Osteocalcin also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP) is a small non-collagenous protein with a molecular weight of approximately 5.8 kDa. This protein is mainly expressed in osteoblasts which are bone-forming cells. It is an important component of the bone matrix and is involved in bone mineralization. Osteocalcin binds to calcium and incorporates into the hydroxyapatite crystals in the bone helping stabilize the bone structure. Researchers often study this protein as a marker for bone formation and turnover.
Biological function summary

Osteocalcin plays a significant role in regulating glucose metabolism and fat deposition. It acts as a hormone from the bone and influences energy metabolism and insulin sensitivity. Osteocalcin undergoes carboxylation a post-translational modification necessary for its function in bone. Beyond its structural role demineralized osteocalcin has been found to impact pancreatic β-cell function adipose tissue and male fertility although the pathways in these processes are not entirely understood yet.

Pathways

Osteocalcin is associated with the energy metabolism and bone remodeling pathways. It interacts with the insulin signaling pathway influencing insulin secretion by pancreatic β-cells and boosting insulin sensitivity. This interaction involves proteins like insulin receptor substrate 1 (IRS1) and glucose transporter type 4 (GLUT4) which play roles in glucose uptake. Osteocalcin also connects to bone remodeling pathways by influencing osteoclast differentiation and activity through osteoprotegrin and receptor activator of nuclear factor kappa-B ligand (RANKL).

Dysregulation of osteocalcin levels associates with metabolic syndrome and osteoporosis. It is linked with insulin resistance affecting glucose homeostasis and potentially contributing to diabetes development. Osteocalcin's involvement in bone density maintenance also makes it relevant in osteoporosis where bone formation balance is disrupted. The receptor activator of nuclear factor kappa-B ligand (RANKL) and osteoprotegrin which osteocalcin interacts with are other proteins connected to the pathogenesis of these conditions. Understanding osteocalcin's function helps in exploring therapeutic targets for these diseases.

Specifications

Form

Liquid

General info

Function

The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein (PubMed : 3019668, PubMed : 6967872). Acts as a negative regulator of bone formation and is required to limit bone formation without impairing bone resorption or mineralization (By similarity). Binds strongly to apatite and calcium upon gamma-carboxylation; this modification is essential for bone metabolism (PubMed : 6967872, PubMed : 39880952).. The uncarboxylated form acts as a hormone secreted by osteoblasts, which regulates different cellular processes, such as energy metabolism, male fertility and brain development. Regulates of energy metabolism by acting as a hormone favoring pancreatic beta-cell proliferation, insulin secretion and sensitivity and energy expenditure. Uncarboxylated osteocalcin hormone also promotes testosterone production in the testes : acts as a ligand for G protein-coupled receptor GPRC6A at the surface of Leydig cells, initiating a signaling response that promotes the expression of enzymes required for testosterone synthesis in a CREB-dependent manner. Also acts as a regulator of brain development : osteocalcin hormone crosses the blood-brain barrier and acts as a ligand for GPR158 on neurons, initiating a signaling response that prevents neuronal apoptosis in the hippocampus, favors the synthesis of all monoamine neurotransmitters and inhibits that of gamma-aminobutyric acid (GABA). Osteocalcin also crosses the placenta during pregnancy and maternal osteocalcin is required for fetal brain development.

Sequence similarities

Belongs to the osteocalcin/matrix Gla protein family.

Post-translational modifications

Carboxylated by vitamin K-dependent GGCX to form gamma-carboxyglutamate; these residues are essential for the binding of calcium (PubMed:6967872, PubMed:39880952). Decarboxylation promotes the hormone activity (By similarity).

Product protocols

Target data

The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein (PubMed : 3019668, PubMed : 6967872). Acts as a negative regulator of bone formation and is required to limit bone formation without impairing bone resorption or mineralization (By similarity). Binds strongly to apatite and calcium upon gamma-carboxylation; this modification is essential for bone metabolism (PubMed : 6967872, PubMed : 39880952).. The uncarboxylated form acts as a hormone secreted by osteoblasts, which regulates different cellular processes, such as energy metabolism, male fertility and brain development. Regulates of energy metabolism by acting as a hormone favoring pancreatic beta-cell proliferation, insulin secretion and sensitivity and energy expenditure. Uncarboxylated osteocalcin hormone also promotes testosterone production in the testes : acts as a ligand for G protein-coupled receptor GPRC6A at the surface of Leydig cells, initiating a signaling response that promotes the expression of enzymes required for testosterone synthesis in a CREB-dependent manner. Also acts as a regulator of brain development : osteocalcin hormone crosses the blood-brain barrier and acts as a ligand for GPR158 on neurons, initiating a signaling response that prevents neuronal apoptosis in the hippocampus, favors the synthesis of all monoamine neurotransmitters and inhibits that of gamma-aminobutyric acid (GABA). Osteocalcin also crosses the placenta during pregnancy and maternal osteocalcin is required for fetal brain development.
See full target information BGLAP

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com