JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159042

Recombinant Human P2X7 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human P2X7 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 595 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

P2X purinoceptor 7, P2X7, ATP receptor, P2Z receptor, Purinergic receptor, P2RX7

1 Images
SDS-PAGE - Recombinant Human P2X7 protein (GST tag N-Terminus) (AB159042)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human P2X7 protein (GST tag N-Terminus) (AB159042)

ab159042 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q99572

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVHEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":595,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q99572","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The P2X7 receptor also known as P2RX7 is a ligand-gated ion channel primarily activated by ATP. It possesses a mass of approximately 68 kDa and is mainly expressed in immune cells like macrophages and microglia. P2X7 functions as a trimer forming a pore in the cell membrane that allows the passage of ions such as calcium (Ca²⁺) and sodium (Na⁺) influencing cell signaling and survival. This receptor is notable for its unique ability to change permeability to larger molecules upon prolonged stimulation with ATP.
Biological function summary

The P2X7 receptor influences immune response and inflammation. It plays a role in the release of pro-inflammatory cytokines like interleukin-1β (IL-1β) therefore participating in the regulation of inflammatory and immune responses. It forms a complex with other purinergic receptors affecting processes such as apoptosis and cell proliferation. The activation of P2X7 can lead to the formation of the inflammasome a component critical for cytokine processing and release.

Pathways

The P2X7 receptor integrates into the NOD-like receptor (NLR) signaling and the purinergic signaling pathways. It interacts with proteins from these pathways including NLRP3 and pannexin-1 which contribute to inflammasome assembly and function. P2X7 also impacts intracellular signaling cascades such as the PI3K/AKT pathway influencing cellular survival and immune responses.

Aberrant P2X7 receptor activity has connections to inflammatory and neurodegenerative conditions. In chronic inflammation the enhanced activity of this receptor can exacerbate diseases like rheumatoid arthritis by promoting excessive cytokine release. It is also associated with neurodegenerative disorders like Alzheimer's disease where P2X7 influences neuroinflammation and neuronal death interacting with proteins such as amyloid-beta.

Specifications

Form

Liquid

General info

Function

ATP-gated nonselective transmembrane cation channel that requires high millimolar concentrations of ATP for activation (PubMed : 17483156, PubMed : 25281740, PubMed : 9038151). Upon ATP binding, it rapidly opens to allow the influx of small cations Na(+) and Ca(2+), and the K(+) efflux (PubMed : 17483156, PubMed : 20453110, PubMed : 28235784, PubMed : 39262850). Also has the ability to form a large pore in the cell membrane, allowing the passage of large cationic molecules (PubMed : 17483156). In microglia, may mediate NADPH transport across the plasma membrane (PubMed : 39142135). In immune cells, P2RX7 acts as a molecular sensor in pathological inflammatory states by detecting and responding to high local concentrations of extracellar ATP. In microglial cells, P2RX7 activation leads to the release of pro-inflammatory cytokines, such as IL-1beta and IL-18, through the activation of the NLRP3 inflammasome and caspase-1 (PubMed : 26877061). Cooperates with KCNK6 to activate NLRP3 inflammasome (By similarity). Activates death pathways leading to apoptosis and autophagy (PubMed : 21821797, PubMed : 23303206, PubMed : 28326637). Activates death pathways leading to pyroptosis (By similarity).. Isoform B. Shows ion channel activity but no macropore function.. Isoform H. Non-functional channel.. Isoform J. Non-functional channel.

Sequence similarities

Belongs to the P2X receptor family.

Post-translational modifications

Phosphorylation results in its inactivation.. ADP-ribosylation at Arg-125 is necessary and sufficient to activate P2RX7 and gate the channel.. Palmitoylation of several cysteines in the C-terminal cytoplasmic tail is required for efficient localization to cell surface (PubMed:18971257). Palmitoylation prevents channel desensitization by physically anchoring the palmitoylated groups to the membrane (By similarity).

Product protocols

Target data

ATP-gated nonselective transmembrane cation channel that requires high millimolar concentrations of ATP for activation (PubMed : 17483156, PubMed : 25281740, PubMed : 9038151). Upon ATP binding, it rapidly opens to allow the influx of small cations Na(+) and Ca(2+), and the K(+) efflux (PubMed : 17483156, PubMed : 20453110, PubMed : 28235784, PubMed : 39262850). Also has the ability to form a large pore in the cell membrane, allowing the passage of large cationic molecules (PubMed : 17483156). In microglia, may mediate NADPH transport across the plasma membrane (PubMed : 39142135). In immune cells, P2RX7 acts as a molecular sensor in pathological inflammatory states by detecting and responding to high local concentrations of extracellar ATP. In microglial cells, P2RX7 activation leads to the release of pro-inflammatory cytokines, such as IL-1beta and IL-18, through the activation of the NLRP3 inflammasome and caspase-1 (PubMed : 26877061). Cooperates with KCNK6 to activate NLRP3 inflammasome (By similarity). Activates death pathways leading to apoptosis and autophagy (PubMed : 21821797, PubMed : 23303206, PubMed : 28326637). Activates death pathways leading to pyroptosis (By similarity).. Isoform B. Shows ion channel activity but no macropore function.. Isoform H. Non-functional channel.. Isoform J. Non-functional channel.
See full target information P2RX7

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com